Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE ACTIVE DOMAIN OF THE HERPES SIMPLEX VIRUS PROTEIN ICP47 IN WATER/SODIUM DODECYL SULFATE SOLUTION DETERMINED BY NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY
 
Authors :  R. Pfaender, L. Neumann, M. Zweckstetter, C. Seger, T. A. Holak, R. Tampe
Date :  09 Sep 99  (Deposition) - 14 Dec 99  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (19x)
Keywords :  Membrane Proteins, Herpes Simplex Virus, Protein Icp47 (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. Pfaender, L. Neumann, M. Zweckstetter, C. Seger, T. A. Holak, R. Tampe
The Structure Of The Active Domain Of The Herpes Simplex Virus Protein Icp47 In Water/Sodium Dodecyl Sulfate Solution Determined By Nuclear Magnetic Resonance Spectroscopy.
Biochemistry V. 38 13692 1999
PubMed-ID: 10521276  |  Reference-DOI: 10.1021/BI9909647

(-) Compounds

Molecule 1 - HERPES SIMPLEX VIRUS PROTEIN ICP47
    ChainsA
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Taxid7108
    FragmentACTIVE DOMAIN
    Organism ScientificHERPES SIMPLEX VIRUS
    Organism Taxid10299
    StrainTYPE 1 - STRAIN 17
    SynonymIMMEDIATE-EARLY PROTEIN IE12, IMMEDIATE-EARLY-5, VMW12

 Structural Features

(-) Chains, Units

  
NMR Structure (19x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1QLO)

(-) Sites  (0, 0)

(no "Site" information available for 1QLO)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1QLO)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1QLO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1QLO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1QLO)

(-) Exons   (0, 0)

(no "Exon" information available for 1QLO)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:34
 aligned with ICP47_HHV11 | P03170 from UniProtKB/Swiss-Prot  Length:88

    Alignment length:34
                                    10        20        30    
           ICP47_HHV11    1 MSWALEMADTFLDTMRVGPRTYADVRDEINKRGR 34
               SCOP domains d1qloa_ A:                         SCOP domains
               CATH domains ---------------------------------- CATH domains
               Pfam domains ---------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhh......hhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------- PROSITE
                 Transcript ---------------------------------- Transcript
                  1qlo A  1 MSWALEMADTFLDNMRVGPRTYADVRDEINKRGR 34
                                    10        20        30    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Peptides (792)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1QLO)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1QLO)

(-) Gene Ontology  (7, 7)

NMR Structure(hide GO term definitions)
Chain A   (ICP47_HHV11 | P03170)
biological process
    GO:0030683    evasion or tolerance by virus of host immune response    Any process, either active or passive, by which a virus avoids the effects of the host organism's immune response. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0019049    evasion or tolerance of host defenses by virus    Any process, either active or passive, by which a virus avoids or tolerates the effects of its host organism's defense(s). Host defenses may be induced by the presence of the virus or may be preformed (e.g. physical barriers). The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0039589    suppression by virus of host TAP complex    Any process in which a virus stops, prevents, or reduces the activity of the host TAP complex, a heterodimer composed of the subunits TAP1 and TAP2 (transporter associated with antigen presentation). The TAP complex functions in the transport of antigenic peptides from the cytosol to the lumen of the endoplasmic reticulum, where they are loaded onto the MHC class I. By inhibiting the TAP complex, the virus prevents viral particles being presented at the cell surface, and thus evades the host immune response.
    GO:0039504    suppression by virus of host adaptive immune response    Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of the adaptive immune response of the host organism, an immune response based on directed amplification of specific receptors for antigen produced through a somatic diversification process, and allowing for enhanced response to subsequent exposures to the same antigen (immunological memory).
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0030430    host cell cytoplasm    The cytoplasm of a host cell.
    GO:0042025    host cell nucleus    A membrane-bounded organelle as it is found in the host cell in which chromosomes are housed and replicated. The host is defined as the larger of the organisms involved in a symbiotic interaction.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1qlo)
 
  Sites
(no "Sites" information available for 1qlo)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1qlo)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1qlo
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ICP47_HHV11 | P03170
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ICP47_HHV11 | P03170
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1QLO)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1QLO)