|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 4)
NMR Structure (1, 4)
|
Sites (4, 4)
NMR Structure (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1QJK) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1QJK) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1QJK) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1QJK) |
Exons (0, 0)| (no "Exon" information available for 1QJK) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:36 aligned with MTA_STRPU | P04734 from UniProtKB/Swiss-Prot Length:64 Alignment length:36 11 21 31 MTA_STRPU 2 PDVKCVCCKEGKECACFGQDCCKTGECCKDGTCCGI 37 SCOP domains d1qjka_ A: Metallothionein SCOP domains CATH domains ------------------------------------ CATH domains Pfam domains Metallothionein-1qjkA01 A:2-37 Pfam domains SAPs(SNPs) ------------------------------------ SAPs(SNPs) PROSITE ------------------------------------ PROSITE Transcript ------------------------------------ Transcript 1qjk A 2 PDVKCVCCTEGKECACFGQDCCVTGECCKDGTCCGI 37 11 21 31
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1QJK) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (1, 1)|
NMR Structure(hide GO term definitions) Chain A (MTA_STRPU | P04734)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|