|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1Q3J) |
Sites (0, 0)| (no "Site" information available for 1Q3J) |
SS Bonds (3, 3)
NMR Structure
|
||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1Q3J) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1Q3J) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1Q3J) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:36 aligned with ALO3_ACRLO | P83653 from UniProtKB/Swiss-Prot Length:36 Alignment length:36 10 20 30 ALO3_ACRLO 1 CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK 36 SCOP domains d1q3ja_ A: Antifungal peptide Alo3 SCOP domains CATH domains ------------------------------------ CATH domains Pfam domains Antifungal_pept-1q3jA01 A:1-36 Pfam domains SAPs(SNPs) ------------------------------------ SAPs(SNPs) PROSITE PLANT_C6_AMP PDB: A:1-33 --- PROSITE Transcript ------------------------------------ Transcript 1q3j A 1 CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK 36 10 20 30
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1Q3J) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (ALO3_ACRLO | P83653)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|