Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  T.GONDII LDH1 COMPLEXED WITH APAD AND SULFATE AT 1.6 ANGSTROMS
 
Authors :  K. L. Kavanagh, R. A. Elling, D. K. Wilson
Date :  10 Jul 03  (Deposition) - 24 Feb 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Apicomplexa, Apad, Tetramer, Rossmann Fold, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. L. Kavanagh, R. A. Elling, D. K. Wilson
Structure Of Toxoplasma Gondii Ldh1: Active-Site Difference From Human Lactate Dehydrogenases And The Structural Basis For Efficient Apad+ Use.
Biochemistry V. 43 879 2004
PubMed-ID: 14744130

(-) Compounds

Molecule 1 - LACTATE DEHYDROGENASE
    Chains: A, B, C, D
    EC Number: 1.1.1.27
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PTYB2
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: LDH1
    Organism Scientific: TOXOPLASMA GONDII
    Organism Taxid: 508771
    Strain: ME49
    Synonym: LDH

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 12)

Asymmetric/Biological Unit (3, 12)
No.NameCountTypeFull Name
1A3D4Ligand/Ion3-ACETYLPYRIDINE ADENINE DINUCLEOTIDE
2CME4Mod. Amino AcidS,S-(2-HYDROXYETHYL)THIOCYSTEINE
3SO44Ligand/IonSULFATE ION

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETRP A:107 , ARG A:109 , ASN A:140 , ARG A:171 , HIS A:195 , GLY A:236 , ALA A:246 , A3D A:601 , HOH A:642BINDING SITE FOR RESIDUE SO4 A 602
2AC2SOFTWARETRP B:107 , ARG B:109 , ASN B:140 , LEU B:167 , ARG B:171 , HIS B:195 , GLY B:236 , ALA B:246 , A3D B:603 , HOH B:618BINDING SITE FOR RESIDUE SO4 B 604
3AC3SOFTWARETRP C:107 , ARG C:109 , ARG C:171 , HIS C:195 , GLY C:236 , A3D C:605 , HOH C:639BINDING SITE FOR RESIDUE SO4 C 606
4AC4SOFTWARETRP D:107 , ARG D:109 , LEU D:167 , ARG D:171 , HIS D:195 , GLY D:236 , ALA D:246 , A3D D:607 , HOH D:635BINDING SITE FOR RESIDUE SO4 D 608
5AC5SOFTWAREGLY A:29 , MET A:30 , ILE A:31 , TYR A:52 , ASP A:53 , VAL A:54 , VAL A:55 , MET A:58 , THR A:97 , ALA A:98 , GLY A:99 , LEU A:100 , THR A:101 , ILE A:119 , VAL A:138 , THR A:139 , ASN A:140 , LEU A:142 , MET A:163 , LEU A:167 , HIS A:195 , ALA A:246 , SO4 A:602 , HOH A:605 , HOH A:610 , HOH A:659 , HOH A:678 , HOH A:694 , HOH A:710 , HOH A:760BINDING SITE FOR RESIDUE A3D A 601
6AC6SOFTWAREGLY B:29 , MET B:30 , ILE B:31 , ASP B:53 , VAL B:54 , VAL B:55 , MET B:58 , THR B:97 , ALA B:98 , GLY B:99 , LEU B:100 , THR B:101 , ILE B:119 , VAL B:138 , THR B:139 , ASN B:140 , LEU B:142 , MET B:163 , LEU B:167 , HIS B:195 , ALA B:246 , PRO B:250 , SO4 B:604 , HOH B:615 , HOH B:619 , HOH B:651 , HOH B:686 , HOH B:716 , HOH B:744 , HOH B:748BINDING SITE FOR RESIDUE A3D B 603
7AC7SOFTWAREGLY C:29 , MET C:30 , ILE C:31 , TYR C:52 , ASP C:53 , VAL C:54 , VAL C:55 , MET C:58 , THR C:97 , ALA C:98 , GLY C:99 , LEU C:100 , THR C:101 , ILE C:119 , VAL C:138 , ASN C:140 , LEU C:142 , MET C:163 , LEU C:167 , HIS C:195 , ALA C:246 , SO4 C:606 , HOH C:613 , HOH C:622 , HOH C:694 , HOH C:721 , HOH C:723BINDING SITE FOR RESIDUE A3D C 605
8AC8SOFTWAREGLY D:29 , MET D:30 , ILE D:31 , ASP D:53 , VAL D:54 , VAL D:55 , MET D:58 , THR D:97 , ALA D:98 , GLY D:99 , LEU D:100 , THR D:101 , ILE D:119 , VAL D:138 , THR D:139 , ASN D:140 , LEU D:142 , MET D:163 , LEU D:167 , HIS D:195 , ALA D:246 , SO4 D:608 , HOH D:612 , HOH D:628 , HOH D:645 , HOH D:716 , HOH D:727 , HOH D:729BINDING SITE FOR RESIDUE A3D D 607

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1PZG)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Asn A:140 -Pro A:141
2Asn B:140 -Pro B:141
3Asn C:140 -Pro C:141
4Asn D:140 -Pro D:141

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1PZG)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1PZG)

(-) Exons   (0, 0)

(no "Exon" information available for 1PZG)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:328
 aligned with P90613_TOXGO | P90613 from UniProtKB/TrEMBL  Length:329

    Alignment length:328
                                                                                                                                                                                                                                                                                                                                                                329 
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322      | 
        P90613_TOXGO      3 PALVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEAALTGADCVIVTAGLTKVPGKPDSEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMCEASGVPTNMICGMACMLDSGRFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQGSAYYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMALNKAVAALQA-    -
               SCOP domains d1pzga1 A:14-163 Lactate dehydrogenase                                                                                                                    d1pzga2 A:164-334 Lactate dehydrogenase                                                                                                                                        SCOP domains
               CATH domains 1pzgA01 A:14-162 NAD(P)-binding Rossmann-like Domain                                                                                                     1pzgA02 A:163-334 L-2-Hydroxyisocaproate Dehydrogenase, subunit A, domain 2                                                                                                     CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeee..hhhhhhhhhhhhhhh..eeeee....hhhhhhhhhhhhhhhhh.....eee..hhhhhhh...eeee..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhhhh.hhh.eee.hhhhhhhhhhhhhhhhhh.hhh.ee..ee.......ee.hhh.ee..eehhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh...eeeeeeeeee.hhh.eeeeeeeeeeee..eeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1pzg A   14 PALVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEAALTGADCVIVTAGLTKVPGKPDSEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMcEASGVPTNMICGMACMLDSGRFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQGSAYYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMALNKAVAALQAP  334
                                    23        33|       44  ||    55        65       |74      ||85||      94      103B|||||  110       120       130 ||    139       149|      159       169       179       189       199      209A|||||  215||    |227       237    |||245       255       265       275       286       296  ||   307       317       326        
                                              33|          47|                     73A|      81|  ||             103A||||||                       132A|               150-CME                                                   209A|||||   216|  223|             242A||                                      283|           299|                    325A|         
                                               35           49                      73B       83  ||              103B|||||                        132B                                                                          209B||||    218   225              242B|                                       285            301                     325B         
                                                                                                86A|               103C||||                                                                                                       209C|||                            242C                                                                                           
                                                                                                 86B                103D|||                                                                                                        209D||                                                                                                                           
                                                                                                                     103E||                                                                                                         210A|                                                                                                                           
                                                                                                                      105A|                                                                                                          210B                                                                                                                           
                                                                                                                       105B                                                                                                                                                                                                                                         


Chain B from PDB  Type:PROTEIN  Length:328
 aligned with P90613_TOXGO | P90613 from UniProtKB/TrEMBL  Length:329

    Alignment length:328
                                                                                                                                                                                                                                                                                                                                                                329 
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322      | 
        P90613_TOXGO      3 PALVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEAALTGADCVIVTAGLTKVPGKPDSEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMCEASGVPTNMICGMACMLDSGRFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQGSAYYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMALNKAVAALQA-    -
               SCOP domains d1pzgb1 B:14-163 Lactate dehydrogenase                                                                                                                    d1pzgb2 B:164-334 Lactate dehydrogenase                                                                                                                                        SCOP domains
               CATH domains 1pzgB01 B:14-162 NAD(P)-binding Rossmann-like Domain                                                                                                     1pzgB02 B:163-334 L-2-Hydroxyisocaproate Dehydrogenase, subunit A, domain 2                                                                                                     CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeee..hhhhhhhhhhhhhhh..eeeee....hhhhhhhhhhhhhhhhh.....eee..hhhhhhh...eeee..........hhhhh.hhhhhhhhhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhhhh.hhh.eee.hhhhhhhhhhhhhhhhhh.hhh.ee..ee.......ee.hhh.ee..eehhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh...eeeeeeeeee.hhh.eeeeeeeeeeee..eeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1pzg B   14 PALVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEAALTGADCVIVTAGLTKVPGKPDSEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMcEASGVPTNMICGMACMLDSGRFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQGSAYYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMALNKAVAALQAP  334
                                    23        33|       44  ||    55        65       |74      ||85||      94      103B|||||  110       120       130 ||    139       149|      159       169       179       189       199      209A|||||  215||    |227       237    |||245       255       265       275       286       296  ||   307       317       326        
                                              33|          47|                     73A|      81|  ||             103A||||||                       132A|               150-CME                                                   209A|||||   216|  223|             242A||                                      283|           299|                    325A|         
                                               35           49                      73B       83  ||              103B|||||                        132B                                                                          209B||||    218   225              242B|                                       285            301                     325B         
                                                                                                86A|               103C||||                                                                                                       209C|||                            242C                                                                                           
                                                                                                 86B                103D|||                                                                                                        209D||                                                                                                                           
                                                                                                                     103E||                                                                                                         210A|                                                                                                                           
                                                                                                                      105A|                                                                                                          210B                                                                                                                           
                                                                                                                       105B                                                                                                                                                                                                                                         


Chain C from PDB  Type:PROTEIN  Length:325
 aligned with P90613_TOXGO | P90613 from UniProtKB/TrEMBL  Length:329

    Alignment length:325
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323     
        P90613_TOXGO      4 ALVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEAALTGADCVIVTAGLTKVPGKPDSEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMCEASGVPTNMICGMACMLDSGRFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQGSAYYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMALNKAVAALQ  328
               SCOP domains d1pzgc1 C:15-163 Lactate dehydrogenase                                                                                                                   d1pzgc2 C:164-332 Lactate dehydrogenase                                                                                                                                      SCOP domains
               CATH domains 1pzgC01 C:15-162 NAD(P)-binding Rossmann-like Domain                                                                                                    1pzgC02 C:163-332 L-2-Hydroxyisocaproate Dehydrogenase, subunit A, domain 2                                                                                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeee..hhhhhhhhhhhhhhh..eeeee....hhhhhhhhhhhhhhhhh.....eee..hhhhhhh...eeee..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhhhh.hhh.eee.hhhhhhhhhhhhhhhhhh.hhh.ee..ee.......ee.hhh.ee..eehhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh...eeeeeeeeee.hhh.eeeeeeeeeeee..eeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1pzg C   15 ALVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEAALTGADCVIVTAGLTKVPGKPDSEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMcEASGVPTNMICGMACMLDSGRFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQGSAYYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMALNKAVAALQ  332
                                    24        35        45 ||     56        66      ||75     ||86A|       95      103C||||   111       121       131||     140       150       160       170       180       190       200      209B||||   216|    ||228       238   ||| 246       256       266       276      |287       297 ||    308       318      |327     
                                             33|          47|                     73A|      81|  ||             103A||||||                       132A|               150-CME                                                   209A|||||   216|  223|             242A||                                      283|           299|                    325A|       
                                              35           49                      73B       83  ||              103B|||||                        132B                                                                          209B||||    218   225              242B|                                       285            301                     325B       
                                                                                               86A|               103C||||                                                                                                       209C|||                            242C                                                                                         
                                                                                                86B                103D|||                                                                                                        209D||                                                                                                                         
                                                                                                                    103E||                                                                                                         210A|                                                                                                                         
                                                                                                                     105A|                                                                                                          210B                                                                                                                         
                                                                                                                      105B                                                                                                                                                                                                                                       


Chain D from PDB  Type:PROTEIN  Length:326
 aligned with P90613_TOXGO | P90613 from UniProtKB/TrEMBL  Length:329

    Alignment length:326
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322      
        P90613_TOXGO      3 PALVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEAALTGADCVIVTAGLTKVPGKPDSEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMCEASGVPTNMICGMACMLDSGRFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQGSAYYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMALNKAVAALQ  328
               SCOP domains d1pzgd1 D:14-163 Lactate dehydrogenase                                                                                                                    d1pzgd2 D:164-332 Lactate dehydrogenase                                                                                                                                      SCOP domains
               CATH domains 1pzgD01 D:14-162 NAD(P)-binding Rossmann-like Domain                                                                                                     1pzgD02 D:163-332 L-2-Hydroxyisocaproate Dehydrogenase, subunit A, domain 2                                                                                                   CATH domains
           Pfam domains (1) -------Ldh_1_N-1pzgD05 D:21-162                                                                                                                          --Ldh_1_C-1pzgD01 D:165-331                                                                                                                                                 - Pfam domains (1)
           Pfam domains (2) -------Ldh_1_N-1pzgD06 D:21-162                                                                                                                          --Ldh_1_C-1pzgD02 D:165-331                                                                                                                                                 - Pfam domains (2)
           Pfam domains (3) -------Ldh_1_N-1pzgD07 D:21-162                                                                                                                          --Ldh_1_C-1pzgD03 D:165-331                                                                                                                                                 - Pfam domains (3)
           Pfam domains (4) -------Ldh_1_N-1pzgD08 D:21-162                                                                                                                          --Ldh_1_C-1pzgD04 D:165-331                                                                                                                                                 - Pfam domains (4)
         Sec.struct. author ........eeeee..hhhhhhhhhhhhhhh..eeeee....hhhhhhhhhhhhhhhhh.....eee..hhhhhhh...eeee..........hhhhh.hhhhhhhhhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhhhh.hhh.eee.hhhhhhhhhhhhhhhhhh.hhh.ee..ee.......ee.hhh.ee..eehhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh...eeeeeeeeee.hhh.eeeeeeeeeeee..eeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1pzg D   14 PALVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEAALTGADCVIVTAGLTKVPGKPDSEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMcEASGVPTNMICGMACMLDSGRFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQGSAYYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMALNKAVAALQ  332
                                    23        33|       44  ||    55        65       |74      ||85||      94      103B|||||  110       120       130 ||    139       149|      159       169       179       189       199      209A|||||  215||    |227       237    |||245       255       265       275       286       296  ||   307       317       326      
                                              33|          47|                     73A|      81|  ||             103A||||||                       132A|               150-CME                                                   209A|||||   216|  223|             242A||                                      283|           299|                    325A|       
                                               35           49                      73B       83  ||              103B|||||                        132B                                                                          209B||||    218   225              242B|                                       285            301                     325B       
                                                                                                86A|               103C||||                                                                                                       209C|||                            242C                                                                                         
                                                                                                 86B                103D|||                                                                                                        209D||                                                                                                                         
                                                                                                                     103E||                                                                                                         210A|                                                                                                                         
                                                                                                                      105A|                                                                                                          210B                                                                                                                         
                                                                                                                       105B
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 8)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (2, 8)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (2, 8)

Asymmetric/Biological Unit
(-)
Clan: LDH_C (56)
(-)
Family: Ldh_1_C (51)
(-)
Toxoplasma gondii (7)
1aLdh_1_C-1pzgD01D:165-331
1bLdh_1_C-1pzgD02D:165-331
1cLdh_1_C-1pzgD03D:165-331
1dLdh_1_C-1pzgD04D:165-331
(-)
Clan: NADP_Rossmann (1239)

(-) Gene Ontology  (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (P90613_TOXGO | P90613)
molecular function
    GO:0004459    L-lactate dehydrogenase activity    Catalysis of the reaction: (S)-lactate + NAD+ = pyruvate + NADH + H+.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016616    oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor    Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group acts as a hydrogen or electron donor and reduces NAD+ or NADP.
biological process
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0019752    carboxylic acid metabolic process    The chemical reactions and pathways involving carboxylic acids, any organic acid containing one or more carboxyl (COOH) groups or anions (COO-).
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    A3D  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CME  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:140 - Pro A:141   [ RasMol ]  
    Asn B:140 - Pro B:141   [ RasMol ]  
    Asn C:140 - Pro C:141   [ RasMol ]  
    Asn D:140 - Pro D:141   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1pzg
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  P90613_TOXGO | P90613
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.1.1.27
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  P90613_TOXGO | P90613
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        P90613_TOXGO | P90613: 1pze 1pzf 1pzh 3om9

(-) Related Entries Specified in the PDB File

1pze T.GONDII LDH1 APO FORM
1pzf T.GONDII LDH1 TERNARY COMPLEX WITH APAD+ AND OXALATE
1pzh T.GONDII LDH1 TERNARY COMPLEX WITH NAD AND OXALATE