Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF PROTEIN OF UNKNOWN FUNCTION YWQG FROM BACILLUS SUBTILIS
 
Authors :  Y. Kim, P. Quartey, A. Joachimiak, Midwest Center For Structural Genomics (Mcsg)
Date :  26 Jun 03  (Deposition) - 20 Jan 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.75
Chains :  Asym./Biol. Unit :  A
Keywords :  Hypothetical Protein, Structural Genomics, Ywqg, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. Kim, P. Quartey, A. Joachimiak
Structure Of Hypothetical Protein Ywqg From Bacillus Subtilis
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN YWQG
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Scientific: BACILLUS SUBTILIS
    Organism Taxid: 1423

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 7)

Asymmetric/Biological Unit (1, 7)
No.NameCountTypeFull Name
1MSE7Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1PV5)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1PV5)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1PV5)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1PV5)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1PV5)

(-) Exons   (0, 0)

(no "Exon" information available for 1PV5)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:261
 aligned with YWQG_BACSU | P96719 from UniProtKB/Swiss-Prot  Length:261

    Alignment length:261
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260 
           YWQG_BACSU     1 MNHLPEKMRPYRDLLEKSAKEYVKLNVRKGKTGRYDSKIAGDPYFPKHETYPTDENGQPMKLLAQINFSHIPQLDGYPSSGILQFYISVHDDVYGLNFDDRCEQKNFRVIYFENIVENDDELVSDFSFIGTGECDFPILSEAAVEPVKSSEWVLPTDFQFEQYTGMETMEFFGQFGEDEEDIYNELAENGFGHKIGGYASFTQHDPREYAYKEHTIMLLQIDSDDDIDSMWGDVGIANFFITPEDLRKKDFSNVLYNWDCS 261
               SCOP domains d1pv5a_ A: Hypothetical protein YwqG                                                                                                                                                                                                                                  SCOP domains
               CATH domains -1pv5A00 A:2-261 Hypothetical protein YwqG domain                                                                                                                                                                                                                     CATH domains
               Pfam domains ------------------------------------DUF1963-1pv5A01 A:37-260                                                                                                                                                                                                        - Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhheeeeeeeeee........ee.....................eeeeeee.hhh..........eeeeee...................eeeeee.....hhhhh...................eeeeeeeeee.......hhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh....eee...................eeeeeee.hhhhh.......eeeeeehhhhhhh......eeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1pv5 A   1 mNHLPEKmRPYRDLLEKSAKEYVKLNVRKGKTGRYDSKIAGDPYFPKHETYPTDENGQPmKLLAQINFSHIPQLDGYPSSGILQFYISVHDDVYGLNFDDRCEQKNFRVIYFENIVENDDELVSDFSFIGTGECDFPILSEAAVEPVKSSEWVLPTDFQFEQYTGmETmEFFGQFGEDEEDIYNELAENGFGHKIGGYASFTQHDPREYAYKEHTImLLQIDSDDDIDSmWGDVGIANFFITPEDLRKKDFSNVLYNWDCS 261
                            |      |10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160     | 170       180       190       200       210      |220       230       240       250       260 
                            |      8-MSE                                              60-MSE                                                                                                   166-MSE                                            217-MSE      230-MSE                           
                            1-MSE                                                                                                                                                                 169-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: DUF1963] (1)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 1PV5)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1pv5)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1pv5)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1pv5
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  YWQG_BACSU | P96719
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  YWQG_BACSU | P96719
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1PV5)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1PV5)