Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE E. COLI PAAI PROTEIN FROM THE PHYENYLACETIC ACID DEGRADATION OPERON
 
Authors :  R. Kniewel, J. Buglino, V. Solorzano, J. Wu, C. D. Lima, S. K. Burley, New Research Center For Structural Genomics (Nysgxrc)
Date :  21 Jun 03  (Deposition) - 08 Jul 03  (Release) - 13 Nov 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Nysgxrc, T820, Phenylacetic Acid, Degradation, Operon, Psi, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  F. Song, Z. Zhuang, L. Finci, D. Dunaway-Mariano, R. Kniewel, J. A. Buglino, V. Solorzano, J. Wu, C. D. Lima
Structure, Function, And Mechanism Of The Phenylacetate Pathway Hot Dog-Fold Thioesterase Paai.
J. Biol. Chem. V. 281 11028 2006
PubMed-ID: 16464851  |  Reference-DOI: 10.1074/JBC.M513896200

(-) Compounds

Molecule 1 - PHENYLACETIC ACID DEGRADATION PROTEIN PAAI
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET T7
    Expression System Strain: B834 DE3
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: PAAI
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 562
    Synonym: PAAI

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 10)

Asymmetric/Biological Unit (1, 10)
No.NameCountTypeFull Name
1MSE10Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1PSU)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1PSU)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1PSU)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1PSU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1PSU)

(-) Exons   (0, 0)

(no "Exon" information available for 1PSU)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:131
 aligned with PAAI_ECOLI | P76084 from UniProtKB/Swiss-Prot  Length:140

    Alignment length:131
                                    10        20        30        40        50        60        70        80        90       100       110       120       130 
           PAAI_ECOLI     1 MSHKAWQNAHAMYENDACAKALGIDIISMDEGFAVVTMTVTAQMLNGHQSCHGGQLFSLADTAFAYACNSQGLAAVASACTIDFLRPGFAGDTLTATAQVRHQGKQTGVYDIEIVNQQQKTVALFRGKSHR 131
               SCOP domains d1psua_ A: Phenylacetic acid degradation protein PaaI                                                                               SCOP domains
               CATH domains -1psuA00 A:2-131  [code=3.10.129.10, no name defined]                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhh.eeeeee..eeeeeee.hhhhh......hhhhhhhhhhhhhhhhhhh.....eeeeeeeee........eeeeeeeeeee...eeeeeeeee.....eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1psu A   1 mSHKAWQNAHAmYENDACAKALGIDIISmDEGFAVVTmTVTAQmLNGHQSCHGGQLFSLADTAFAYACNSQGLAAVASACTIDFLRPGFAGDTLTATAQVRHQGKQTGVYDIEIVNQQQKTVALFRGKSHR 131
                            |       10 |      20        30       |40   |    50        60        70        80        90       100       110       120       130 
                            |         12-MSE           29-MSE   38-MSE |                                                                                       
                            1-MSE                                     44-MSE                                                                                   


Chain B from PDB  Type:PROTEIN  Length:137
 aligned with PAAI_ECOLI | P76084 from UniProtKB/Swiss-Prot  Length:140

    Alignment length:137
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       
           PAAI_ECOLI     1 MSHKAWQNAHAMYENDACAKALGIDIISMDEGFAVVTMTVTAQMLNGHQSCHGGQLFSLADTAFAYACNSQGLAAVASACTIDFLRPGFAGDTLTATAQVRHQGKQTGVYDIEIVNQQQKTVALFRGKSHRIGGTIT 137
               SCOP domains d1psub_ B: Phenylacetic acid degradation protein PaaI                                                                                     SCOP domains
               CATH domains -1psuB00 B:2-137  [code=3.10.129.10, no name defined]                                                                                     CATH domains
           Pfam domains (1) -----------------------------------------------4HBT-1psuB01 B:48-123                                                       -------------- Pfam domains (1)
           Pfam domains (2) -----------------------------------------------4HBT-1psuB02 B:48-123                                                       -------------- Pfam domains (2)
         Sec.struct. author hhhhhhhhhhhhhh.hhhhhhh..eeeeee..eeeeeee.hhhhh......hhhhhhhhhhhhhhhhhhh....eeeeeeeeee........eeeeeeeeeee...eeeeeeeee.....eeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1psu B   1 mSHKAWQNAHAmYENDACAKALGIDIISmDEGFAVVTmTVTAQmLNGHQSCHGGQLFSLADTAFAYACNSQGLAAVASACTIDFLRPGFAGDTLTATAQVRHQGKQTGVYDIEIVNQQQKTVALFRGKSHRIGGTIT 137
                            |       10 |      20        30       |40   |    50        60        70        80        90       100       110       120       130       
                            1-MSE     12-MSE           29-MSE   38-MSE |                                                                                             
                                                                      44-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: HotDog (52)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (PAAI_ECOLI | P76084)
molecular function
    GO:0016289    CoA hydrolase activity    Catalysis of the reaction: X-CoA + H2O = X + CoA; X may be any group.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016790    thiolester hydrolase activity    Catalysis of the reaction: RCO-SR' + H2O = RCOOH + HSR'. This reaction is the hydrolysis of a thiolester bond, an ester formed from a carboxylic acid and a thiol (i.e., RCO-SR'), such as that found in acetyl-coenzyme A.
biological process
    GO:0010124    phenylacetate catabolic process    The chemical reactions and pathways resulting in the breakdown of phenylacetate.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1psu)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1psu)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1psu
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PAAI_ECOLI | P76084
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PAAI_ECOLI | P76084
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PAAI_ECOLI | P76084: 2fs2

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1PSU)