|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (1, 2) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (5, 5)
Asymmetric Unit
|
||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1POC) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1POC) |
PROSITE Motifs (1, 1)| Asymmetric Unit (1, 1) Biological Unit 1 (1, 2) |
Exons (0, 0)| (no "Exon" information available for 1POC) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:134 aligned with PA2_APIME | P00630 from UniProtKB/Swiss-Prot Length:167 Alignment length:134 43 53 63 73 83 93 103 113 123 133 143 153 163 PA2_APIME 34 IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTRLSCDCDDKFYDCLKNSADTISSYFVGKMYFNLIDTKCYKLEHPVTGCGERTEGRCLHYTVDKSKPKVYQWFDLRKY 167 SCOP domains d1poca_ A: Phospholipase A2 SCOP domains CATH domains 1pocA00 A:1-134 Phospholipase A2 CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----------------------------PA2_HIS ------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript 1poc A 1 IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTRLSCDCDDKFYDCLKNSADTISSYFVGKMYFNLIDTKCYKLEHPVTGCGERTEGRCLHYTVDKSKPKVYQWFDLRKY 134 10 20 30 40 50 60 70 80 90 100 110 120 130
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1POC) |
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A (PA2_APIME | P00630)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|