1PHR - JenaLib

Title :   THE CRYSTAL STRUCTURE OF A LOW MOLECULAR PHOSPHOTYROSINE PROTEIN PHOSPHATASE

Authors :   X. -D. Su, N. Taddei, M. Stefani, G. Ramponi, P. Nordlund

Date :   05 Jul 94 (Deposition) - 31 Jul 95 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.10

Chains :   Asym./Biol. Unit : A

Keywords :   Phosphotyrosine Protein Phosphatase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   X. D. Su, N. Taddei, M. Stefani, G. Ramponi, P. Nordlund
The Crystal Structure Of A Low-Molecular-Weight Phosphotyrosine Protein Phosphatase.
Nature V. 370 575 1994
PubMed-ID: 8052313 | Reference-DOI: 10.1038/370575A0
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (6, 6)

Asymmetric/Biological Unit (6, 6)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSBTAT00000027314	1	ENSBTAE00000374382	Un.004.59:239636-239739	104	PPAC_BOVIN	1-15	15	1	A:4-14	11
1.2	ENSBTAT00000027314	2	ENSBTAE00000222586	Un.004.59:243950-244023	74	PPAC_BOVIN	15-39	25	1	A:14-38	25
1.4	ENSBTAT00000027314	4	ENSBTAE00000222587	Un.004.59:244272-244385	114	PPAC_BOVIN	40-77	38	1	A:39-76	38
1.5	ENSBTAT00000027314	5	ENSBTAE00000222588	Un.004.59:251012-251073	62	PPAC_BOVIN	78-98	21	1	A:77-97	21
1.6	ENSBTAT00000027314	6	ENSBTAE00000222589	Un.004.59:252850-252955	106	PPAC_BOVIN	98-133	36	1	A:97-132	36
1.7	ENSBTAT00000027314	7	ENSBTAE00000041204	Un.004.59:253109-254058	950	PPAC_BOVIN	134-158	25	1	A:133-157	25

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:154
 aligned with PPAC_BOVIN | P11064 from UniProtKB/Swiss-Prot  Length:158

    Alignment length:154
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154    
           PPAC_BOVIN     5 VTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR 158
               SCOP domains d1phra_ A: Tyrosine phosphatase                                                                                                                            SCOP domains
               CATH domains 1phrA00 A:4-157  [code=3.40.50.270, no name defined]                                                                                                       CATH domains
               Pfam domains ----LMWPc-1phrA01 A:8-153                                                                                                                             ---- Pfam domains
         Sec.struct. author ..eeeeeee.....hhhhhhhhhhhhhhh...hhheeeeeee...........hhhhhhhhhh............hhhhhh..eeee..hhhhhhhhhhhhh......eeeehhhh...............hhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1   ------------------------Exon 1.4  PDB: A:39-76 UniProt: 40-77 Exon 1.5  PDB: A:77-9-----------------------------------Exon 1.7  PDB: A:133-157  Transcript 1 (1)
           Transcript 1 (2) ----------Exon 1.2  PDB: A:14-38   ----------------------------------------------------------Exon 1.6  PDB: A:97-132             ------------------------- Transcript 1 (2)
                 1phr A   4 VTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR 157
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (PPAC_BOVIN | P11064)

molecular function
	GO:0003993	acid phosphatase activity	Catalysis of the reaction: an orthophosphoric monoester + H2O = an alcohol + phosphate, with an acid pH optimum.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0004726	non-membrane spanning protein tyrosine phosphatase activity	Catalysis of the reaction: non-membrane spanning protein tyrosine phosphate + H2O = non-membrane spanning protein tyrosine + phosphate.
	GO:0004721	phosphoprotein phosphatase activity	Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
	GO:0004725	protein tyrosine phosphatase activity	Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
biological process
	GO:0035335	peptidyl-tyrosine dephosphorylation	The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1phr)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)
Insightii
	ribbon, secondary structure, sulfate [ mono GIF format \| stereo GIF format ]
	ribbon, secondary structure, sulfate, water [ mono GIF format \| stereo GIF format ]
	ribbon, sticks, sulfate [ mono GIF format \| stereo GIF format ]
Midas
	ribbon, secondary structure, sulfate [ mono GIF format \| stereo GIF format ]
	ribbon, secondary structure, sulfate, residue specific coloring [ mono GIF format \| stereo GIF format ]
	spacefill, water [ mono GIF format \| stereo GIF format ]
Setor
	ribbon, labeling, sulfate [ mono GIF format \| stereo GIF format ]
	ribbon, secondary structure, labeling, sulfate [ mono GIF format \| stereo GIF format ]
	ribbon, secondary structure, labeling, sticks, sulfate [ mono GIF format \| stereo GIF format ]
	spacefill, sulfate [ mono GIF format \| stereo GIF format ]
Distance Plot
	representative atom: CA [ mono GIF format \| mono PDF format ]

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1phr
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PPAC_BOVIN \| P11064
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.48
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PPAC_BOVIN \| P11064
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description