![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (1, 4)
|
(no "Site" information available for 1PFP) |
(no "SS Bond" information available for 1PFP) |
(no "Cis Peptide Bond" information available for 1PFP) |
(no "SAP(SNP)/Variant" information available for 1PFP) |
Asymmetric/Biological Unit (2, 2)
|
(no "Exon" information available for 1PFP) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:87 aligned with PG3_PIG | P32196 from UniProtKB/Swiss-Prot Length:149 Alignment length:98 40 50 60 70 80 90 100 110 120 PG3_PIG 31 ALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLDQIKDPLDITCNEVQ 128 SCOP domains d1pfpa_ A: Cathelicidin motif of protegrin-3 SCOP domains CATH domains 1pfpA00 A:31-128 [code=3.10.450 .10, no name defined] CATH domains Pfam domains Cathelicidins-1pfpA01 A:31-97 ----------------- --------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---CATHELICIDINS_------------------------------CATHELICIDINS_2 ---------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------- Transcript 1pfp A 31 ALSYREAVLRAVDRLNEQSSEANLYRLLELDQ------DPGTPKPVSFTVKETVxPRPTRQPPELxDFKENGRVKQxVGTVTLD-----LDITxNEVQ 128 40 50 60 | 70 80 | 90 | 100 |110 | 120 | 62 69 85-SEC 96-SEC 107-SEC114 120 | 124-SEC
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
Asymmetric/Biological Unit(hide GO term definitions) Chain A (PG3_PIG | P32196)
|
|
|
|
|
|
|