|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1P65) |
Sites (0, 0)| (no "Site" information available for 1P65) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1P65) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1P65) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1P65) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1P65) |
Exons (0, 0)| (no "Exon" information available for 1P65) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:57 aligned with Q9YJI1_PRRSV | Q9YJI1 from UniProtKB/TrEMBL Length:123 Alignment length:57 71 81 91 101 111 Q9YJI1_PRRSV 62 DVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVT 118 SCOP domains d1p65a_ A: Arterivirus nucleocapsid protein SCOP domains CATH domains --------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------- PROSITE Transcript --------------------------------------------------------- Transcript 1p65 A 11 DVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVT 67 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:57 aligned with Q9YJI1_PRRSV | Q9YJI1 from UniProtKB/TrEMBL Length:123 Alignment length:57 71 81 91 101 111 Q9YJI1_PRRSV 62 DVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVT 118 SCOP domains d1p65b_ B: Arterivirus nucleocapsid protein SCOP domains CATH domains --------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------- PROSITE Transcript --------------------------------------------------------- Transcript 1p65 B 11 DVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVT 67 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1P65) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1P65) |
Gene Ontology (1, 1)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q9YJI1_PRRSV | Q9YJI1)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|