|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 6)
|
Asymmetric Unit (7, 7)
|
(no "SS Bond" information available for 1OXQ) |
(no "Cis Peptide Bond" information available for 1OXQ) |
(no "SAP(SNP)/Variant" information available for 1OXQ) |
Asymmetric Unit (2, 10)
|
Asymmetric Unit (3, 15)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:99 aligned with BIRC7_HUMAN | Q96CA5 from UniProtKB/Swiss-Prot Length:298 Alignment length:99 80 90 100 110 120 130 140 150 160 BIRC7_HUMAN 71 AGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQET 169 SCOP domains d1oxqa_ A: BIR-containing protein 7 (ML-IAP, livin) SCOP domains CATH domains 1oxqA00 A:71-169 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ----------------BIR_REPEAT_1 PDB: A:87-154 UniProt: 87-154 --------------- PROSITE (1) PROSITE (2) -------------------BIR_REPEAT_2 PDB: A:90-155 UniProt: 90-155 -------------- PROSITE (2) Transcript 1 (1) Exon 1.1 PDB: A:71-117 UniProt: 1-117 --------------------------------Exon 1.3c Transcript 1 (1) Transcript 1 (2) ----------------------------------------------Exon 1.2 PDB: A:117-150 ------------------- Transcript 1 (2) 1oxq A 71 AGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQET 169 80 90 100 110 120 130 140 150 160 Chain B from PDB Type:PROTEIN Length:101 aligned with BIRC7_HUMAN | Q96CA5 from UniProtKB/Swiss-Prot Length:298 Alignment length:101 80 90 100 110 120 130 140 150 160 170 BIRC7_HUMAN 71 AGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHS 171 SCOP domains d1oxqb_ B: BIR-containing protein 7 (ML-IAP, livin) SCOP domains CATH domains 1oxqB00 B:71-171 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ----------------BIR_REPEAT_1 PDB: B:87-154 UniProt: 87-154 ----------------- PROSITE (1) PROSITE (2) -------------------BIR_REPEAT_2 PDB: B:90-155 UniProt: 90-155 ---------------- PROSITE (2) Transcript 1 (1) Exon 1.1 PDB: B:71-117 UniProt: 1-117 --------------------------------Exon 1.3c [INCOMPLETE] Transcript 1 (1) Transcript 1 (2) ----------------------------------------------Exon 1.2 PDB: B:117-150 --------------------- Transcript 1 (2) 1oxq B 71 AGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHS 171 80 90 100 110 120 130 140 150 160 170 Chain C from PDB Type:PROTEIN Length:101 aligned with BIRC7_HUMAN | Q96CA5 from UniProtKB/Swiss-Prot Length:298 Alignment length:101 80 90 100 110 120 130 140 150 160 170 BIRC7_HUMAN 71 AGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHS 171 SCOP domains d1oxqc_ C: BIR-containing protein 7 (ML-IAP, livin) SCOP domains CATH domains 1oxqC00 C:71-171 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ----------------BIR_REPEAT_1 PDB: C:87-154 UniProt: 87-154 ----------------- PROSITE (1) PROSITE (2) -------------------BIR_REPEAT_2 PDB: C:90-155 UniProt: 90-155 ---------------- PROSITE (2) Transcript 1 (1) Exon 1.1 PDB: C:71-117 UniProt: 1-117 --------------------------------Exon 1.3c [INCOMPLETE] Transcript 1 (1) Transcript 1 (2) ----------------------------------------------Exon 1.2 PDB: C:117-150 --------------------- Transcript 1 (2) 1oxq C 71 AGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHS 171 80 90 100 110 120 130 140 150 160 170 Chain D from PDB Type:PROTEIN Length:100 aligned with BIRC7_HUMAN | Q96CA5 from UniProtKB/Swiss-Prot Length:298 Alignment length:100 80 90 100 110 120 130 140 150 160 170 BIRC7_HUMAN 71 AGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETH 170 SCOP domains d1oxqd_ D: BIR-containing protein 7 (ML-IAP, livin) SCOP domains CATH domains 1oxqD00 D:71-170 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains ---------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ----------------BIR_REPEAT_1 PDB: D:87-154 UniProt: 87-154 ---------------- PROSITE (1) PROSITE (2) -------------------BIR_REPEAT_2 PDB: D:90-155 UniProt: 90-155 --------------- PROSITE (2) Transcript 1 (1) Exon 1.1 PDB: D:71-117 UniProt: 1-117 --------------------------------Exon 1.3c Transcript 1 (1) Transcript 1 (2) ----------------------------------------------Exon 1.2 PDB: D:117-150 -------------------- Transcript 1 (2) 1oxq D 71 AGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETH 170 80 90 100 110 120 130 140 150 160 170 Chain E from PDB Type:PROTEIN Length:94 aligned with BIRC7_HUMAN | Q96CA5 from UniProtKB/Swiss-Prot Length:298 Alignment length:94 87 97 107 117 127 137 147 157 167 BIRC7_HUMAN 78 GPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHS 171 SCOP domains d1oxqe_ E: BIR-containing protein 7 (ML-IAP, livin) SCOP domains CATH domains 1oxqE00 E:78-171 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains (1) ------------BIR-1oxqE01 E:90-155 ---------------- Pfam domains (1) Pfam domains (2) ------------BIR-1oxqE02 E:90-155 ---------------- Pfam domains (2) Pfam domains (3) ------------BIR-1oxqE03 E:90-155 ---------------- Pfam domains (3) Pfam domains (4) ------------BIR-1oxqE04 E:90-155 ---------------- Pfam domains (4) Pfam domains (5) ------------BIR-1oxqE05 E:90-155 ---------------- Pfam domains (5) SAPs(SNPs) ---------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---------BIR_REPEAT_1 PDB: E:87-154 UniProt: 87-154 ----------------- PROSITE (1) PROSITE (2) ------------BIR_REPEAT_2 PDB: E:90-155 UniProt: 90-155 ---------------- PROSITE (2) Transcript 1 (1) Exon 1.1 PDB: E:78-117 UniProt: 1-117 --------------------------------Exon 1.3c [INCOMPLETE] Transcript 1 (1) Transcript 1 (2) ---------------------------------------Exon 1.2 PDB: E:117-150 --------------------- Transcript 1 (2) 1oxq E 78 GPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHS 171 87 97 107 117 127 137 147 157 167 Chain F from PDB Type:PROTEIN Length:4 aligned with DBLOH_HUMAN | Q9NR28 from UniProtKB/Swiss-Prot Length:239 Alignment length:4 DBLOH_HUMAN 56 AVPI 59 SCOP domains ---- SCOP domains CATH domains ---- CATH domains Pfam domains ---- Pfam domains SAPs(SNPs) ---- SAPs(SNPs) PROSITE ---- PROSITE Transcript ---- Transcript 1oxq F 1 AVPI 4
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D,E (BIRC7_HUMAN | Q96CA5)
Chain F (DBLOH_HUMAN | Q9NR28)
|
|
|
|
|
|
|