1OWA - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURAL STUDIES ON HUMAN ERYTHROCYTE ALPHA SPECTRIN N TERMINAL TETRAMERIZATION DOMAIN

Authors :   S. Park, M. S. Caffrey, M. E. Johnson, L. W. Fung

Date :   28 Mar 03 (Deposition) - 30 Mar 04 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (10x)

Keywords :   Triple Helical Bundle, Cytokine (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Park, M. S. Caffrey, M. E. Johnson, L. W. Fung
Solution Structural Studies On Human Erythrocyte Alpha-Spectrin Tetramerization Site.
J. Biol. Chem. V. 278 21837 2003
PubMed-ID: 12672815 | Reference-DOI: 10.1074/JBC.M300617200
(for further references see the PDB file header)

Molecule 1 - SPECTRIN ALPHA CHAIN, ERYTHROCYTE
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	RESIDUES 1-156
	Gene	:	SPTA1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	ERYTHROID ALPHA-SPECTRIN


NMR Structure (10x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1OWA)

(no "Site" information available for 1OWA)

(no "SS Bond" information available for 1OWA)

(no "Cis Peptide Bond" information available for 1OWA)

NMR Structure (16, 16)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_001324	I	24	S	SPTA1_HUMAN	Disease (EL2)	---	A	I	24	S
02	UniProt	VAR_001328	R	28	C	SPTA1_HUMAN	Disease (EL2)	121918642	A	R	28	C
03	UniProt	VAR_001325	R	28	H	SPTA1_HUMAN	Disease (EL2)	28934004	A	R	28	H
04	UniProt	VAR_001326	R	28	L	SPTA1_HUMAN	Disease (EL2)	121918641	A	R	28	L
05	UniProt	VAR_001327	R	28	S	SPTA1_HUMAN	Disease (EL2)	28934005	A	R	28	S
06	UniProt	VAR_001329	V	31	A	SPTA1_HUMAN	Disease (EL2)	773826036	A	V	31	A
07	UniProt	VAR_001330	R	34	W	SPTA1_HUMAN	Disease (EL2)	201568233	A	R	34	W
08	UniProt	VAR_001331	R	41	W	SPTA1_HUMAN	Disease (EL2)	121918640	A	R	41	W
09	UniProt	VAR_001332	R	45	S	SPTA1_HUMAN	Disease (EL2)	121918637	A	R	45	S
10	UniProt	VAR_001333	R	45	T	SPTA1_HUMAN	Disease (EL2)	---	A	R	45	T
11	UniProt	VAR_001334	G	46	V	SPTA1_HUMAN	Disease (EL2)	121918638	A	G	46	V
12	UniProt	VAR_001335	K	48	R	SPTA1_HUMAN	Disease (HPP)	121918644	A	K	48	R
13	UniProt	VAR_001336	L	49	F	SPTA1_HUMAN	Disease (EL2)	121918639	A	L	49	F
14	UniProt	VAR_038506	S	109	F	SPTA1_HUMAN	Polymorphism	3737521	A	S	109	F
15	UniProt	VAR_001337	G	151	D	SPTA1_HUMAN	Disease (EL2)	199725919	A	G	151	D
16	UniProt	VAR_038507	D	152	N	SPTA1_HUMAN	Polymorphism	16840544	A	D	152	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 1OWA)

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000368147	1b	ENSE00001849919	chr1:158656445-158656284	162	SPTA1_HUMAN	1-8	8	1	A:1-8	8
1.2b	ENST00000368147	2b	ENSE00001075897	chr1:158655137-158654898	240	SPTA1_HUMAN	9-88	80	1	A:9-88	80
1.3	ENST00000368147	3	ENSE00001075943	chr1:158653286-158653161	126	SPTA1_HUMAN	89-130	42	1	A:89-130	42
1.4	ENST00000368147	4	ENSE00001075925	chr1:158651457-158651317	141	SPTA1_HUMAN	131-177	47	1	A:131-156	26
1.5	ENST00000368147	5	ENSE00001075935	chr1:158650519-158650373	147	SPTA1_HUMAN	178-226	49	0	-	-
1.6	ENST00000368147	6	ENSE00001075933	chr1:158648324-158648191	134	SPTA1_HUMAN	227-271	45	0	-	-
1.7b	ENST00000368147	7b	ENSE00001075907	chr1:158647624-158647480	145	SPTA1_HUMAN	271-319	49	0	-	-
1.8	ENST00000368147	8	ENSE00001075956	chr1:158646085-158645931	155	SPTA1_HUMAN	320-371	52	0	-	-
1.9	ENST00000368147	9	ENSE00001075916	chr1:158644465-158644330	136	SPTA1_HUMAN	371-416	46	0	-	-
1.10	ENST00000368147	10	ENSE00001075972	chr1:158644220-158644119	102	SPTA1_HUMAN	417-450	34	0	-	-
1.11	ENST00000368147	11	ENSE00001075927	chr1:158641986-158641849	138	SPTA1_HUMAN	451-496	46	0	-	-
1.12	ENST00000368147	12	ENSE00001659491	chr1:158641243-158641133	111	SPTA1_HUMAN	497-533	37	0	-	-
1.13	ENST00000368147	13	ENSE00001075969	chr1:158639576-158639499	78	SPTA1_HUMAN	534-559	26	0	-	-
1.14	ENST00000368147	14	ENSE00001075904	chr1:158639353-158639198	156	SPTA1_HUMAN	560-611	52	0	-	-
1.15	ENST00000368147	15	ENSE00001075908	chr1:158637852-158637648	205	SPTA1_HUMAN	612-680	69	0	-	-
1.16	ENST00000368147	16	ENSE00001075974	chr1:158636287-158636106	182	SPTA1_HUMAN	680-740	61	0	-	-
1.17	ENST00000368147	17	ENSE00001075895	chr1:158632735-158632492	244	SPTA1_HUMAN	741-822	82	0	-	-
1.18	ENST00000368147	18	ENSE00001075939	chr1:158631199-158631077	123	SPTA1_HUMAN	822-863	42	0	-	-
1.19	ENST00000368147	19	ENSE00001075951	chr1:158627484-158627267	218	SPTA1_HUMAN	863-935	73	0	-	-
1.20	ENST00000368147	20	ENSE00001075967	chr1:158626446-158626354	93	SPTA1_HUMAN	936-966	31	0	-	-
1.21	ENST00000368147	21	ENSE00001075892	chr1:158624538-158624401	138	SPTA1_HUMAN	967-1012	46	0	-	-
1.22	ENST00000368147	22	ENSE00001075954	chr1:158623215-158623064	152	SPTA1_HUMAN	1013-1063	51	0	-	-
1.23	ENST00000368147	23	ENSE00001075906	chr1:158622443-158622257	187	SPTA1_HUMAN	1063-1125	63	0	-	-
1.24	ENST00000368147	24	ENSE00001075924	chr1:158621258-158621157	102	SPTA1_HUMAN	1126-1159	34	0	-	-
1.25	ENST00000368147	25	ENSE00001075891	chr1:158619737-158619646	92	SPTA1_HUMAN	1160-1190	31	0	-	-
1.26	ENST00000368147	26	ENSE00001075901	chr1:158618443-158618299	145	SPTA1_HUMAN	1190-1238	49	0	-	-
1.27	ENST00000368147	27	ENSE00001075973	chr1:158617510-158617329	182	SPTA1_HUMAN	1239-1299	61	0	-	-
1.28	ENST00000368147	28	ENSE00001075889	chr1:158615384-158615285	100	SPTA1_HUMAN	1299-1332	34	0	-	-
1.29	ENST00000368147	29	ENSE00001075941	chr1:158615175-158614978	198	SPTA1_HUMAN	1333-1398	66	0	-	-
1.30	ENST00000368147	30	ENSE00001075949	chr1:158614186-158614043	144	SPTA1_HUMAN	1399-1446	48	0	-	-
1.31	ENST00000368147	31	ENSE00001075899	chr1:158613215-158613112	104	SPTA1_HUMAN	1447-1481	35	0	-	-
1.32	ENST00000368147	32	ENSE00001075911	chr1:158612766-158612604	163	SPTA1_HUMAN	1481-1535	55	0	-	-
1.33a	ENST00000368147	33a	ENSE00001075965	chr1:158612332-158612201	132	SPTA1_HUMAN	1536-1579	44	0	-	-
1.34	ENST00000368147	34	ENSE00001075890	chr1:158609797-158609660	138	SPTA1_HUMAN	1580-1625	46	0	-	-
1.35a	ENST00000368147	35a	ENSE00001075931	chr1:158609476-158609372	105	SPTA1_HUMAN	1626-1660	35	0	-	-
1.36	ENST00000368147	36	ENSE00001075947	chr1:158608031-158607823	209	SPTA1_HUMAN	1661-1730	70	0	-	-
1.37	ENST00000368147	37	ENSE00001075959	chr1:158606551-158606431	121	SPTA1_HUMAN	1730-1770	41	0	-	-
1.38	ENST00000368147	38	ENSE00001075970	chr1:158605824-158605703	122	SPTA1_HUMAN	1771-1811	41	0	-	-
1.39a	ENST00000368147	39a	ENSE00001075914	chr1:158604465-158604333	133	SPTA1_HUMAN	1811-1855	45	0	-	-
1.40	ENST00000368147	40	ENSE00001075929	chr1:158597513-158597415	99	SPTA1_HUMAN	1856-1888	33	0	-	-
1.41b	ENST00000368147	41b	ENSE00001446421	chr1:158596788-158596629	160	SPTA1_HUMAN	1889-1942	54	0	-	-
1.42	ENST00000368147	42	ENSE00001075928	chr1:158596012-158595936	77	SPTA1_HUMAN	1942-1967	26	0	-	-
1.43a	ENST00000368147	43a	ENSE00001075888	chr1:158592982-158592773	210	SPTA1_HUMAN	1968-2037	70	0	-	-
1.44b	ENST00000368147	44b	ENSE00001075971	chr1:158590256-158589960	297	SPTA1_HUMAN	2038-2136	99	0	-	-
1.45a	ENST00000368147	45a	ENSE00001075921	chr1:158589124-158589012	113	SPTA1_HUMAN	2137-2174	38	0	-	-
1.46b	ENST00000368147	46b	ENSE00001723857	chr1:158587846-158587829	18	SPTA1_HUMAN	2174-2180	7	0	-	-
1.47a	ENST00000368147	47a	ENSE00001075918	chr1:158587378-158587327	52	SPTA1_HUMAN	2180-2197	18	0	-	-
1.48a	ENST00000368147	48a	ENSE00001075937	chr1:158585193-158585006	188	SPTA1_HUMAN	2198-2260	63	0	-	-
1.49b	ENST00000368147	49b	ENSE00001075961	chr1:158584096-158584043	54	SPTA1_HUMAN	2260-2278	19	0	-	-
1.50	ENST00000368147	50	ENSE00001075952	chr1:158583657-158583511	147	SPTA1_HUMAN	2278-2327	50	0	-	-
1.51a	ENST00000368147	51a	ENSE00001075963	chr1:158582751-158582607	145	SPTA1_HUMAN	2327-2375	49	0	-	-
1.53b	ENST00000368147	53b	ENSE00001446423	chr1:158581179-158580396	784	SPTA1_HUMAN	2376-2416	41	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:156
 aligned with SPTA1_HUMAN | P02549 from UniProtKB/Swiss-Prot  Length:2419

    Alignment length:156
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150      
          SPTA1_HUMAN     1 MEQFPKETVVESSGPKVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLR 156
               SCOP domains d1owaa_ A: Spectrin alpha chain                                                                                                                              SCOP domains
               CATH domains ------------------1owaA01 A:19-50                 1owaA02 A:51-156  [code=1.20.58.60, no name defined]                                                       CATH domains
               Pfam domains ----------------------------------------------------Spectrin-1owaA01 A:53-156                                                                                Pfam domains
         Sec.struct. author ...................hhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) -----------------------S---C--A--W------W---SV-RF-----------------------------------------------------------F-----------------------------------------DN---- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------H----------------T--------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---------------------------L-------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ---------------------------S-------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
               Transcript 1 1.1b    Exon 1.2b  PDB: A:9-88 UniProt: 9-88                                            Exon 1.3  PDB: A:89-130 UniProt: 89-130   Exon 1.4  PDB: A:131-156   Transcript 1
                 1owa A   1 MEQFPKETVVESSGPKVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLR 156
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Spectrin repeat-like (186)

Superfamily: Spectrin repeat (10)

Family: Spectrin repeat (9)

Protein domain: Spectrin alpha chain (6)

Human (Homo sapiens) [TaxId: 9606] (1)

d1owaa_

NMR Structure

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Spectrin] (10)

Family: Spectrin (10)

Homo sapiens (Human) (8)

Spectrin-1owaA01

A:53-156

NMR Structure(hide GO term definitions)

Chain A (SPTA1_HUMAN | P02549)

molecular function
	GO:0005088	Ras guanyl-nucleotide exchange factor activity	Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Ras superfamily. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0051015	actin filament binding	Interacting selectively and non-covalently with an actin filament, also known as F-actin, a helical filamentous polymer of globular G-actin subunits.
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046982	protein heterodimerization activity	Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
	GO:0005200	structural constituent of cytoskeleton	The action of a molecule that contributes to the structural integrity of a cytoskeletal structure.
biological process
	GO:0006888	ER to Golgi vesicle-mediated transport	The directed movement of substances from the endoplasmic reticulum (ER) to the Golgi, mediated by COP II vesicles. Small COP II coated vesicles form from the ER and then fuse directly with the cis-Golgi. Larger structures are transported along microtubules to the cis-Golgi.
	GO:0000165	MAPK cascade	An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
	GO:0030036	actin cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
	GO:0051693	actin filament capping	The binding of a protein or protein complex to the end of an actin filament, thus preventing the addition, exchange or removal of further actin subunits.
	GO:0007015	actin filament organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments. Includes processes that control the spatial distribution of actin filaments, such as organizing filaments into meshworks, bundles, or other structures, as by cross-linking.
	GO:0007411	axon guidance	The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
	GO:0030097	hemopoiesis	The process whose specific outcome is the progression of the myeloid and lymphoid derived organ/tissue systems of the blood and other parts of the body over time, from formation to the mature structure. The site of hemopoiesis is variable during development, but occurs primarily in bone marrow or kidney in many adult vertebrates.
	GO:0002260	lymphocyte homeostasis	The process of regulating the proliferation and elimination of lymphocytes such that the total number of lymphocytes within a whole or part of an organism is stable over time in the absence of an outside stimulus.
	GO:0007009	plasma membrane organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the plasma membrane.
	GO:0006779	porphyrin-containing compound biosynthetic process	The chemical reactions and pathways resulting in the formation of any member of a large group of derivatives or analogs of porphyrin. Porphyrin consists of a ring of four pyrrole nuclei linked each to the next at their alpha positions through a methine group.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0042102	positive regulation of T cell proliferation	Any process that activates or increases the rate or extent of T cell proliferation.
	GO:0032092	positive regulation of protein binding	Any process that activates or increases the frequency, rate or extent of protein binding.
	GO:0008360	regulation of cell shape	Any process that modulates the surface configuration of a cell.
cellular component
	GO:0015629	actin cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
	GO:0005938	cell cortex	The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins.
	GO:0030863	cortical cytoskeleton	The portion of the cytoskeleton that lies just beneath the plasma membrane.
	GO:0032437	cuticular plate	A dense network of actin filaments found beneath the apical cell surface of hair cells, and into which stereocilia are inserted.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0031235	intrinsic component of the cytoplasmic side of the plasma membrane	The component of a plasma membrane consisting of gene products and protein complexes that have some covalently attached part (e.g. peptide sequence or GPI anchor) which is embedded in the cytoplasmic side of the plasma membrane only.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0008091	spectrin	Membrane associated dimeric protein (240 and 220 kDa) of erythrocytes. Forms a complex with ankyrin, actin and probably other components of the membrane cytoskeleton, so that there is a mesh of proteins underlying the plasma membrane, potentially restricting the lateral mobility of integral proteins.
	GO:0014731	spectrin-associated cytoskeleton	The part of the cytoskeleton composed of spectrin, protein 4.1 and ankyrin. Spectrin-associated cytoskeleton is associated with the plasma membrane.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1owa)

	Sites
(no "Sites" information available for 1owa)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1owa)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1owa
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SPTA1_HUMAN \| P02549
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	130600
		Disease Information	:	OMIM
	266140
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SPTA1_HUMAN \| P02549
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	SPTA1_HUMAN \| P02549	:	3lbx 5j4o

(no "Related Entries Specified in the PDB File" available for 1OWA)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (16, 16)

PROSITE Motifs (0, 0)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (2, 2)

Pfam Domains (1, 1)

Gene Ontology (33, 33)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File