Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF MEX67-MTR2
 
Authors :  S. Fribourg, E. Conti
Date :  08 Apr 03  (Deposition) - 03 Jul 03  (Release) - 30 Jan 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Transport, Mrna Transport, Nuclear Protein, Repeat, Leucine- Rich Repeat, Nuclear Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Fribourg, E. Conti
Structural Similarity In The Absence Of Sequence Homology Of The Messenger Rna Export Factors Mtr2 And P15
Embo Rep. V. 4 699 2003
PubMed-ID: 12835756  |  Reference-DOI: 10.1038/SJ.EMBOR.EMBOR883

(-) Compounds

Molecule 1 - MRNA EXPORT FACTOR MEX67
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: NTF2-LIKE DOMAIN, RESIDUES 268-484
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
    Synonym: MEX67, YPL169C, P2520
 
Molecule 2 - MRNA TRANSPORT REGULATOR MTR2
    Chains: B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
    Synonym: MTR2, YKL186C

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1HG1Ligand/IonMERCURY (II) ION

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN B:46 , ASN B:48 , CYS B:50 , ALA B:60BINDING SITE FOR RESIDUE HG A 1

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1OF5)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1OF5)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1OF5)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1NTF2_DOMAINPS50177 Nuclear transport factor 2 domain profile.MEX67_YEAST280-467  1A:280-467

(-) Exons   (2, 2)

Asymmetric/Biological Unit (2, 2)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1YKL186C1YKL186C.1XI:93303-92749555MTR2_YEAST1-1841841B:14-178 (gaps)165
2.1YPL169C1YPL169C.1XVI:230837-2290381800MEX67_YEAST1-5995991A:268-488 (gaps)221

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:154
 aligned with MEX67_YEAST | Q99257 from UniProtKB/Swiss-Prot  Length:599

    Alignment length:221
                                   277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487 
          MEX67_YEAST   268 QQFFFENDALGQSSTDFATNFLNLWDNNREQLLNLYSPQSQFSVSVDSTIPPSTVTDSDQTPAFGYYMSSSRNISKVSSEKSIQQRLSIGQESINSIFKTLPKTKHHLQEQPNEYSMETISYPQINGFVITLHGFFEETGKPELESNKKTGKNNYQKNRRYNHGYNSTSNNKLSKKSFDRTWVIVPMNNSVIIASDLLTVRAYSTGAWKTASIAIAQPPQQ 488
               SCOP domains d1of5a_ A: NTF2-like domain of mRNA export factor                                       MEX67                                                                                                                                 SCOP domains
               CATH domains 1of5A00 A:268-488  [code=3.10.450.50, no name def                                      ined]                                                                                                                                  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeee...--------------------------------------.hhhhhhhhhhhhh..eee....hhhh.eeeeeeehhhheeeeeeeeeeee.-----------------------------.....eeeeeeeeeeeeee..eeeeeeeeeeeee.............eeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------NTF2_DOMAIN  PDB: A:280-467 UniProt: 280-467                                                                                                                                                --------------------- PROSITE
               Transcript 2 Exon 2.1  PDB: A:268-488 (gaps) UniProt: 1-599 [INCOMPLETE]                                                                                                                                                                   Transcript 2
                 1of5 A 268 QQFFFENDALGQSSTDFATNFLNLWDNNREQLLNLYSPQSQFSVSVDST--------------------------------------SIGQESINSIFKTLPKTKHHLQEQPNEYSMETISYPQINGFVITLHGFFEET-----------------------------SNNKLSKKSFDRTWVIVPMNNSVIIASDLLTVRAYSTGAWKTASIAIAQAAGS 488
                                   277       287       297       307        |-         -         -         -       357       367       377       387       397        |-         -         -       437       447       457       467       477       487 
                                                                          316                                    355                                                406                           436                                                    


Chain B from PDB  Type:PROTEIN  Length:128
 aligned with MTR2_YEAST | P34232 from UniProtKB/Swiss-Prot  Length:184

    Alignment length:165
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173     
           MTR2_YEAST    14 NQAQITATFTKKILAHLDDPDSNKLAQFVQLFNPNNCRIIFNATPFAQATVFLQMWQNQVVQTQHALTGVDYHAIPGSGTLICNVNCKVRFDESGRDKMGQDATVPIQPNNTGNRNRPNDMNKPRPLWGPYFGISLQLIIDDRIFRNDFNGVISGFNYNMVYKPE 178
               SCOP domains d1of5b_ B: mRNA transpo rt regulato r MTR2                                                                                                                            SCOP domains
               CATH domains 1of5B00 B:14-178  [code =3.10.450.5 0, no name defined]                                                                                                               CATH domains
               Pfam domains Mtr2-1of5B01 B:14-178                                                                                                                                                 Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh....-hhhhhh.....-..eee..eee.hhhhhhhhhhhhh...eeeeeeeeeeee....eeeeeeeeeee..-----------------------------------....eeeeeeeeee.hhhhh.....eeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: B:14-178 (gaps) UniProt: 1-184 [INCOMPLETE]                                                                                                            Transcript 1
                 1of5 B  14 NQAQITATFTKKILAHLDDPDSN-LAQFVQLFNPN-CRIIFNATPFAQATVFLQMWQNQVVQTQHALTGVDYHAIPGSGTLICNVNCKVRFD-----------------------------------WGPYFGISLQLIIDDRIFRNDFNGVISGFNYNMVYKPE 178
                                    23        33  | |   43    | | 53        63        73        83        93       103 |       -         -         -       143       153       163       173     
                                                 36 |        48 |                                                    105                                 141                                     
                                                   38          50
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: NTF2 (66)

(-) Gene Ontology  (12, 20)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (MEX67_YEAST | Q99257)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006406    mRNA export from nucleus    The directed movement of mRNA from the nucleus to the cytoplasm.
    GO:0051028    mRNA transport    The directed movement of mRNA, messenger ribonucleic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0016973    poly(A)+ mRNA export from nucleus    The directed movement of poly(A)+ mRNA out of the nucleus into the cytoplasm.
    GO:0000055    ribosomal large subunit export from nucleus    The directed movement of a ribosomal large subunit from the nucleus into the cytoplasm.
    GO:0000056    ribosomal small subunit export from nucleus    The directed movement of a ribosomal small subunit from the nucleus into the cytoplasm.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0042272    nuclear RNA export factor complex    A protein complex that contains two proteins (know in several organisms, including Drosophila, as NXF1 and NXF2) and is required for the export of the majority of mRNAs from the nucleus to the cytoplasm; localized in the nucleoplasm and at both the nucleoplasmic and cytoplasmic faces of the nuclear pore complex; shuttles between the nucleus and the cytoplasm.
    GO:0005643    nuclear pore    Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B   (MTR2_YEAST | P34232)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0016973    poly(A)+ mRNA export from nucleus    The directed movement of poly(A)+ mRNA out of the nucleus into the cytoplasm.
    GO:0000055    ribosomal large subunit export from nucleus    The directed movement of a ribosomal large subunit from the nucleus into the cytoplasm.
    GO:0000056    ribosomal small subunit export from nucleus    The directed movement of a ribosomal small subunit from the nucleus into the cytoplasm.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0042272    nuclear RNA export factor complex    A protein complex that contains two proteins (know in several organisms, including Drosophila, as NXF1 and NXF2) and is required for the export of the majority of mRNAs from the nucleus to the cytoplasm; localized in the nucleoplasm and at both the nucleoplasmic and cytoplasmic faces of the nuclear pore complex; shuttles between the nucleus and the cytoplasm.
    GO:0005643    nuclear pore    Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1of5)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1of5
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MEX67_YEAST | Q99257
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  MTR2_YEAST | P34232
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  MEX67_YEAST | Q99257
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  MTR2_YEAST | P34232
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MEX67_YEAST | Q99257: 2jp7 2khh 4wwu
        MTR2_YEAST | P34232: 4wwu

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1OF5)