|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1OAW) |
Sites (0, 0)| (no "Site" information available for 1OAW) |
SS Bonds (4, 4)
NMR Structure
|
||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1OAW) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1OAW) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1OAW) |
Exons (0, 0)| (no "Exon" information available for 1OAW) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:48 aligned with TOG4A_AGEAP | P30288 from UniProtKB/Swiss-Prot Length:48 Alignment length:48 10 20 30 40 TOG4A_AGEAP 1 KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA 48 SCOP domains d1oawa_ A: omega-Agatoxin IV, IVa, IVb SCOP domains CATH domains 1oawA00 A:1-48 CATH domains Pfam domains ---Toxin_9-1oawA01 A:4-48 Pfam domains SAPs(SNPs) ------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------ PROSITE Transcript ------------------------------------------------ Transcript 1oaw A 1 KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA 48 10 20 30 40
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (TOG4A_AGEAP | P30288)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|