|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1O78) |
Sites (0, 0)| (no "Site" information available for 1O78) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1O78) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1O78) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1O78) |
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1O78) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:84 aligned with BCCP_PROFR | P02904 from UniProtKB/Swiss-Prot Length:123 Alignment length:123 10 20 30 40 50 60 70 80 90 100 110 120 BCCP_PROFR 1 MKLKVTVNGTAYDVDVDVDKSHENPMGTILFGGGTGGAPAPRAAGGAGAGKAGEGEIPAPLAGTVSKILVKEGDTVKAGQTVLVLEAMKMETEINAPTDGKVEKVLVKERDAVQGGQGLIKIG 123 SCOP domains d1o78a_ A: Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) SCOP domains CATH domains 1o78A00 A:1-84 [code=2.40.50.100, no name defined] CATH domains Pfam domains ------------------------------------------------------Biotin_lipoyl-1o78A01 A:16-83 - Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---------------------------------------------BIOTINYL_LIPOYL PDB: A:9-84 UniProt: 46-123 PROSITE (1) PROSITE (2) ------------------------------------------------------------------------------BIOTIN --------------------------- PROSITE (2) Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript 1o78 A 1 MKLKVTVN---------------------------------------GAGKAGEGEIPAPLAGTVSKILVKEGDTVKAGQTVLVLEAMKMETEINAPTDGKVEKVLVKERDAVQGGQGLIKIG 84 | - - - - |11 21 31 41 51 61 71 81 8 9
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (BCCP_PROFR | P02904)
|
||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|