|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric/Biological Unit (1, 2)
|
Sites (0, 0)| (no "Site" information available for 1O13) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1O13) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1O13) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1O13) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1O13) |
Exons (0, 0)| (no "Exon" information available for 1O13) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:107 aligned with Q9X2D6_THEMA | Q9X2D6 from UniProtKB/TrEMBL Length:124 Alignment length:107 10 20 30 40 50 60 70 80 90 100 Q9X2D6_THEMA 1 MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIVRGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQ 107 SCOP domains d1o13a_ A: Hypothetical protein TM1816 SCOP domains CATH domains -1o13A00 A:2-107 [code=3.30.420.130, no name defined] CATH domains Pfam domains ------------Nitro_FeMo-Co-1o13A01 A:13-105 -- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------- Transcript 1o13 A 1 mIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIVRGIGRRAIAAFEAmGVKVIKGASGTVEEVVNQYLSGQ 107 | 10 20 30 40 50 60 70 80 | 90 100 | 84-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1O13)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|