![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 3) Biological Unit 1 (1, 1) Biological Unit 2 (0, 0) |
Asymmetric Unit (3, 3)
|
(no "SS Bond" information available for 1NYC) |
(no "Cis Peptide Bond" information available for 1NYC) |
(no "SAP(SNP)/Variant" information available for 1NYC) |
(no "PROSITE Motif" information available for 1NYC) |
(no "Exon" information available for 1NYC) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:111 aligned with SSPC_STAAW | Q7A189 from UniProtKB/Swiss-Prot Length:109 Alignment length:111 1 | 8 18 28 38 48 58 68 78 88 98 108 SSPC_STAAW - --MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDTAHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV 109 SCOP domains d1nyca_ A: Staphostatin B (SspC) SCOP domains CATH domains 1nycA00 A:-1-109 Staphostatins CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------- Transcript 1nyc A -1 GSMYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDTAHQRIKFSSFDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV 109 8 18 28 38 48 58 68 78 88 98 108 Chain B from PDB Type:PROTEIN Length:111 aligned with SSPC_STAAW | Q7A189 from UniProtKB/Swiss-Prot Length:109 Alignment length:111 1 | 8 18 28 38 48 58 68 78 88 98 108 SSPC_STAAW - --MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDTAHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV 109 SCOP domains d1nycb_ B: Staphostatin B (SspC) SCOP domains CATH domains 1nycB00 B:-1-109 Staphostatins CATH domains Pfam domains (1) --Staphostatin_B-1nycB01 B:1-107 -- Pfam domains (1) Pfam domains (2) --Staphostatin_B-1nycB02 B:1-107 -- Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------- Transcript 1nyc B -1 GSMYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDTAHQRIKFSSFDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV 109 8 18 28 38 48 58 68 78 88 98 108
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B (SSPC_STAAW | Q7A189)
|
|
|
|
|
|
|