|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1NY8) |
Sites (0, 0)| (no "Site" information available for 1NY8) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1NY8) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1NY8) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1NY8) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1NY8) |
Exons (0, 0)| (no "Exon" information available for 1NY8) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:97 aligned with IBAG_ECOLI | P0A9W6 from UniProtKB/Swiss-Prot Length:84 Alignment length:97 1 84 | 5 15 25 35 45 55 65 75 |- IBAG_ECOLI - -----MENNEIQSVLMNALSLQEVHVSGDGSHFQVIAVGELFDGMSRVKKQQTVYGPLMEYIADNRIHAVSIKAYTPAEWARDRKLNGF-------- - SCOP domains d1ny8a_ A: Hypothetical protein YrbA SCOP domains CATH domains 1ny8A00 A:1-97 BolA-like CATH domains Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------- Transcript 1ny8 A 1 MIEDPMENNEIQSVLMNALSLQEVHVSGDGSHFQVIAVGELFDGMSRVKKQQTVYGPLMEYIADNRIHAVSIKAYTPAEWARDRKLNGFLEHHHHHH 97 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1NY8) |
Gene Ontology (1, 1)|
NMR Structure(hide GO term definitions) Chain A (IBAG_ECOLI | P0A9W6)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|