Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF VIBRIO CHOLERAE PROTEIN VC0424
 
Authors :  T. A. Ramelot, S. Ni, S. Goldsmith-Fischman, J. R. Cort, B. Honig, M. A. Kennedy, Northeast Structural Genomics Consortium (Nesg)
Date :  10 Feb 03  (Deposition) - 01 Jul 03  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Structural Genomics, Ab Sandwich, Cog 3076, Atcc No. 51394D, Nesg Target Op3, Psi, Protein Structure Initiative, Northeast Structural Genomics Consortium, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. A. Ramelot, S. Ni, S. Goldsmith-Fischman, J. R. Cort, B. Honig, M. A. Kennedy
Solution Structure Of Vibrio Cholerae Protein Vc0424: A Variation Of The Ferredoxin-Like Fold.
Protein Sci. V. 12 1556 2003
PubMed-ID: 12824501  |  Reference-DOI: 10.1110/PS.03108103
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CONSERVED HYPOTHETICAL PROTEIN VC0424
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28B
    Expression System Strain: ROSETTA (LAMDADE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: VC0424
    Organism Scientific: VIBRIO CHOLERAE
    Organism Taxid: 666

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1NXI)

(-) Sites  (0, 0)

(no "Site" information available for 1NXI)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1NXI)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1NXI)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1NXI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1NXI)

(-) Exons   (0, 0)

(no "Exon" information available for 1NXI)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:132
 aligned with Q9KUU1_VIBCH | Q9KUU1 from UniProtKB/TrEMBL  Length:140

    Alignment length:140
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140
         Q9KUU1_VIBCH     1 MSHQDDYLSVEELIEIQKEETRDIIQALLEDGSDPDALYEIEHHLFAEDFDKLEKAAVEAFKMGFEVLEAEETEDEDGNKLLCFDATMQSALDAKLIDEQVEKLVNLAEKFDIIYDGWGTYYEGEDALYSDEDEDEDDEH 140
               SCOP domains d1nxia_ A: Hypothetical protein VC0424                                                                                                       SCOP domains
               CATH domains 1nxiA00 A:1-132  [code=3.30.70.970, no name defined]                                                                                         CATH domains
               Pfam domains ---------------DUF1260-1nxiA01 A:16-120                                                                                 -------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeeee.hhhhhhhhhhhhhhhh.................eeeeeeeee..hhhhhhhhhhhhhhhhhhhh.eeeeeee....--------........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1nxi A   1 MSHQDDYLSVEELIEIQKEETRDIIQALLEDGSDPDALYEIEHHLFAEDFDKLEKAAVEAFKMGFEVLEAEETEDEDGNKLLCFDATMQSALDAKLIDEQVEKLVNLAEKFDIIYDGWGTYYEG--------LEHHHHHH 132
                                    10        20        30        40        50        60        70        80        90       100       110       120   |     -  |    132
                                                                                                                                                     124      125
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: DUF1260] (1)

(-) Gene Ontology  (8, 8)

NMR Structure(hide GO term definitions)
Chain A   (Q9KUU1_VIBCH | Q9KUU1)
molecular function
    GO:0060698    endoribonuclease inhibitor activity    Stops, prevents or reduces the activity of an endoribonuclease, any enzyme that catalyzes the hydrolysis of ester linkages within ribonucleic acid by creating internal breaks.
    GO:0019899    enzyme binding    Interacting selectively and non-covalently with any enzyme.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
biological process
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
    GO:0060702    negative regulation of endoribonuclease activity    Any process that decreases the rate, frequency or extent of the catalysis of the hydrolysis of ester linkages within ribonucleic acid by creating internal breaks.
    GO:0060699    regulation of endoribonuclease activity    Any process that modulates the rate, frequency or extent of the catalysis of the hydrolysis of ester linkages within ribonucleic acid by creating internal breaks.
cellular component
    GO:0005575    cellular_component    The part of a cell, extracellular environment or virus in which a gene product is located. A gene product may be located in one or more parts of a cell and its location may be as specific as a particular macromolecular complex, that is, a stable, persistent association of macromolecules that function together.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1nxi)
 
  Sites
(no "Sites" information available for 1nxi)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1nxi)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1nxi
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9KUU1_VIBCH | Q9KUU1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9KUU1_VIBCH | Q9KUU1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1NXI)

(-) Related Entries Specified in the PDB File

5589 RELATED ID: OP3 RELATED DB: TARGETDB