Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  X-RAY STRUCTURE: NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET TT87
 
Authors :  R. Khayat, A. Savchenko, A. Edwards, C. Arowsmith, L. Tong, Northeast Structural Genomics Consortium (Nesg)
Date :  10 Feb 03  (Deposition) - 24 Feb 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Hypothetical Protein, Disulfide Bonds, Homodimer, Structural Genomics, Psi, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Khayat, A. Savchenko, A. Edwards, C. Arowsmith, L. Tong
X-Ray Structure Of Mth396
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MTH396 PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: MTH396
    Organism Scientific: METHANOTHERMOBACTER THERMAUTOTROPHICUS
    Organism Taxid: 145262
    Synonym: CONSERVED PROTEIN

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 10)

Asymmetric/Biological Unit (1, 10)
No.NameCountTypeFull Name
1MSE10Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1NXH)

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:66 -B:278
2A:78 -B:266

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1NXH)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1NXH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1NXH)

(-) Exons   (0, 0)

(no "Exon" information available for 1NXH)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:124
 aligned with O26496_METTH | O26496 from UniProtKB/TrEMBL  Length:126

    Alignment length:124
                                    12        22        32        42        52        62        72        82        92       102       112       122    
         O26496_METTH     3 EGELMRLMKRRILESYRWQEDVVKPLSRELEIDVEEFQDILMDKLDMSSLEALHPRFESARPRCIREKLHSDLQLCWLVDVMEIISVDDAEALKDEITELVLAGREYSEALSEGRRRLHEILRS 126
               SCOP domains d1nxha_ A: Hypothetical protein MTH393                                                                                       SCOP domains
               CATH domains 1nxhA00 A:3-126 Hypothetical protein MTH393                                                                                  CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1nxh A   3 EGELmRLmKRRILESYRWQEDVVKPLSRELEIDVEEFQDILmDKLDmSSLEALHPRFESARPRCIREKLHSDLQLCWLVDVmEIISVDDAEALKDEITELVLAGREYSEALSEGRRRLHEILRS 126
                                |  |12        22        32        42 |    | 52        62        72        82 |      92       102       112       122    
                                |  |                                44-MSE|                                 84-MSE                                      
                                7-MSE                                    49-MSE                                                                         
                                  10-MSE                                                                                                                


Chain B from PDB  Type:PROTEIN  Length:118
 aligned with O26496_METTH | O26496 from UniProtKB/TrEMBL  Length:126

    Alignment length:122
                                    14        24        34        44        54        64        74        84        94       104       114       124  
         O26496_METTH     5 ELMRLMKRRILESYRWQEDVVKPLSRELEIDVEEFQDILMDKLDMSSLEALHPRFESARPRCIREKLHSDLQLCWLVDVMEIISVDDAEALKDEITELVLAGREYSEALSEGRRRLHEILRS 126
               SCOP domains d1nxhb_ B: Hypothetical pro    tein MTH393                                                                                 SCOP domains
               CATH domains 1nxhB00 B:205-326 Hypotheti    cal protein MTH393                                                                          CATH domains
           Pfam domains (1) ------DUF1959-1nxhB01 B:211    -325                                                                                      - Pfam domains (1)
           Pfam domains (2) ------DUF1959-1nxhB02 B:211    -325                                                                                      - Pfam domains (2)
         Sec.struct. author hhhhhhhhhhhhhhhhhhhh.......----hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript
                 1nxh B 205 ELmRLmKRRILESYRWQEDVVKPLSRE----VEEFQDILmDKLDmSSLEALHPRFESARPRCIREKLHSDLQLCWLVDVmEIISVDDAEALKDEITELVLAGREYSEALSEGRRRLHEILRS 326
                              |  | 214       224      |  - |     244    |  254       264       274       284       294       304       314       324  
                            207-MSE                 231  236     244-MSE|                                284-MSE                                      
                               210-MSE                                249-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: DUF1959] (1)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 1NXH)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1nxh)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1nxh)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1nxh
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O26496_METTH | O26496
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  O26496_METTH | O26496
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1NXH)

(-) Related Entries Specified in the PDB File

tt87