Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  LIMONENE-1,2-EPOXIDE HYDROLASE
 
Authors :  M. Arand, B. M. Hallberg, J. Zou, T. Bergfors, F. Oesch, M. J. Van Der Werf, J. A. M. De Bont, T. A. Jones, S. L. Mowbray
Date :  07 Feb 03  (Deposition) - 10 Jun 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.20
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Epoxide Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Arand, B. M. Hallberg, J. Zou, T. Bergfors, F. Oesch, M. J. Van Der Werf, J. A. M. De Bont, T. A. Jones, S. L. Mowbray
Structure Of Rhodococcus Erythropolis Limonene-1, 2-Epoxide Hydrolase Reveals A Novel Active Site
Embo J. V. 22 2583 2003
PubMed-ID: 12773375  |  Reference-DOI: 10.1093/EMBOJ/CDG275
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - LIMONENE-1,2-EPOXIDE HYDROLASE
    Chains: A, B
    EC Number: 3.3.2.8
    Organism Scientific: RHODOCOCCUS ERYTHROPOLIS
    Organism Taxid: 1833
    Strain: DCL14

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric/Biological Unit (2, 3)
No.NameCountTypeFull Name
1HPN2Ligand/IonHEPTANAMIDE
2MES1Ligand/Ion2-(N-MORPHOLINO)-ETHANESULFONIC ACID

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:58 , MET A:78 , ARG A:99 , ASP A:101 , LEU A:103 , ASP A:132 , PHE A:134 , HOH A:201BINDING SITE FOR RESIDUE HPN A 900
2AC2SOFTWARELEU B:58 , MET B:78 , ARG B:99 , ASP B:101 , LEU B:103 , ASP B:132 , PHE B:134 , HOH B:1211BINDING SITE FOR RESIDUE HPN B 1900
3AC3SOFTWAREASP A:50 , THR A:51 , THR A:128 , HOH A:302 , HOH A:354 , ARG B:9 , ASP B:50 , THR B:51 , GLY B:63 , HOH B:1230 , HOH B:1298BINDING SITE FOR RESIDUE MES A 901

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1NWW)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1NWW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1NWW)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1NWW)

(-) Exons   (0, 0)

(no "Exon" information available for 1NWW)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:145
 aligned with LIMA_RHOER | Q9ZAG3 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:145
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144     
           LIMA_RHOER     5 IEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSIDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNLSILGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG 149
               SCOP domains d1nwwa_ A: Limonene-1,2-epoxide hydrolase                                                                                                         SCOP domains
               CATH domains 1nwwA00 A:5-149  [code=3.10.450.50, no name defined]                                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .................hhhhhhhhhhhhhhhhhhhhhhhh......eeee.....eehhhhhhhhhhhhhhheeeeeeeeeeeeee..eeeeeeeeeeee.....eeeeeeeeeeeee..eeeeeeee.hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1nww A   5 IEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSIDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNLSILGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG 149
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144     


Chain B from PDB  Type:PROTEIN  Length:146
 aligned with LIMA_RHOER | Q9ZAG3 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:146
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143      
           LIMA_RHOER     4 KIEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSIDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNLSILGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG 149
               SCOP domains d1nwwb_ B: Limonene-1,2-epoxide hydrolase                                                                                                          SCOP domains
               CATH domains 1nwwB00 B:4-149  [code=3.10.450.50, no name defined]                                                                                               CATH domains
           Pfam domains (1) ------------------LEH-1nwwB01 B:22-145                                                                                                        ---- Pfam domains (1)
           Pfam domains (2) ------------------LEH-1nwwB02 B:22-145                                                                                                        ---- Pfam domains (2)
         Sec.struct. author ..........hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh....eeee.....eehhhhhhhhhhhhhhheeeeeeeeeeeeee..eeeeeeeeeeee.....eeeeeeeeeeeee..eeeeeeee.hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1nww B   4 KIEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSIDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNLSILGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG 149
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: NTF2 (66)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (LIMA_RHOER | Q9ZAG3)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0018744    limonene-1,2-epoxide hydrolase activity    Catalysis of the reaction: limonene-1,2-epoxide + H2O = limonene-1,2-diol. Other substrates include alicyclic and 1-methyl-substituted epoxides, such as 1-methylcyclohexene oxide, indene oxide and cyclohexene oxide.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HPN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MES  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1nww)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1nww
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LIMA_RHOER | Q9ZAG3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.3.2.8
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  LIMA_RHOER | Q9ZAG3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LIMA_RHOER | Q9ZAG3: 1nu3 4r9k 4r9l 4xbt 4xbx 4xby 4xdv 4xdw 5cf1 5cf2 5ck6 5clk 5gkw 5jpp 5jpu

(-) Related Entries Specified in the PDB File

1nu3 LIMONENE EPOXIDE HYDROLASE IN COMPLEX WITH VALPROMIDE