1NTG - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE EMAP II-LIKE CYTOKINE RELEASED FROM HUMAN TYROSYL-TRNA SYNTHETASE

Authors :   X. -L. Yang, R. J. Skene, D. E. Mcree, P. Schimmel

Date :   29 Jan 03 (Deposition) - 13 May 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.21

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)

Keywords :   Beta Barrel, Ligase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   X. -L. Yang, J. Liu, R. J. Skene, D. E. Mcree, P. Schimmel
Crystal Structure Of An Emap-Ii-Like Cytokine Released From A Human Trna Synthetase
Helv. Chim. Acta V. 86 1246 2003
PubMed: search | Reference-DOI: 10.1002/HLCA.200390107
(for further references see the PDB file header)

Molecule 1 - TYROSYL-TRNA SYNTHETASE
	Chains	:	A, B, C, D
	EC Number	:	6.1.1.1
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET20B
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	C-TYRRS
	Gene	:	YARS
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TYRRS

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1NTG)

(no "Site" information available for 1NTG)

(no "SS Bond" information available for 1NTG)

(no "Cis Peptide Bond" information available for 1NTG)

(no "SAP(SNP)/Variant" information available for 1NTG)

Asymmetric Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRBD	PS50886	tRNA-binding domain profile.	SYYC_HUMAN	364-468	4	A:6-110 B:6-110 C:6-110 D:6-110

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRBD	PS50886	tRNA-binding domain profile.	SYYC_HUMAN	364-468	1	A:6-110 - - -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRBD	PS50886	tRNA-binding domain profile.	SYYC_HUMAN	364-468	1	- B:6-110 - -

Biological Unit 3 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRBD	PS50886	tRNA-binding domain profile.	SYYC_HUMAN	364-468	1	- - C:6-110 -

Biological Unit 4 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRBD	PS50886	tRNA-binding domain profile.	SYYC_HUMAN	364-468	1	- - - D:6-110

Asymmetric Unit (4, 16)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000373477	1a	ENSE00001460665	chr1:33283754-33282789	966	SYYC_HUMAN	1-19	19	0	-	-
1.2b	ENST00000373477	2b	ENSE00001208748	chr1:33276658-33276512	147	SYYC_HUMAN	20-68	49	0	-	-
1.3b	ENST00000373477	3b	ENSE00001208739	chr1:33276367-33276192	176	SYYC_HUMAN	69-127	59	0	-	-
1.4a	ENST00000373477	4a	ENSE00001208728	chr1:33272212-33272083	130	SYYC_HUMAN	127-170	44	0	-	-
1.5b	ENST00000373477	5b	ENSE00001208722	chr1:33263444-33263364	81	SYYC_HUMAN	171-197	27	0	-	-
1.7a	ENST00000373477	7a	ENSE00001208715	chr1:33256855-33256763	93	SYYC_HUMAN	198-228	31	0	-	-
1.8	ENST00000373477	8	ENSE00000916656	chr1:33252676-33252541	136	SYYC_HUMAN	229-274	46	0	-	-
1.9c	ENST00000373477	9c	ENSE00000916655	chr1:33252048-33251963	86	SYYC_HUMAN	274-302	29	0	-	-
1.10b	ENST00000373477	10b	ENSE00001065998	chr1:33248140-33248005	136	SYYC_HUMAN	303-348	46	0	-	-
1.11b	ENST00000373477	11b	ENSE00001065997	chr1:33246746-33246649	98	SYYC_HUMAN	348-380	33	4	A:2-22 B:2-22 C:2-22 D:2-22	21 21 21 21
1.12b	ENST00000373477	12b	ENSE00001168511	chr1:33245879-33245686	194	SYYC_HUMAN	381-445	65	4	A:23-87 B:23-87 C:23-87 D:23-87	65 65 65 65
1.12c	ENST00000373477	12c	ENSE00001065999	chr1:33245124-33244983	142	SYYC_HUMAN	445-492	48	4	A:87-134 B:87-134 C:87-134 D:87-134	48 48 48 48
1.13d	ENST00000373477	13d	ENSE00001460663	chr1:33241692-33240840	853	SYYC_HUMAN	493-528	36	4	A:135-170 B:135-170 C:135-170 D:135-170	36 36 36 36

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:171
 aligned with SYYC_HUMAN | P54577 from UniProtKB/Swiss-Prot  Length:528

    Alignment length:171
                                                                                                                                                                                                  528  
                                   369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519        |- 
           SYYC_HUMAN   360 PEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS--   -
               SCOP domains d1ntga_ A: C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS                                                                                                     SCOP domains
               CATH domains 1ntgA00 A:2-172 Nucleic acid-binding proteins                                                                                                                               CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhh.eeeeeeeeeee.......eeeeee......eeeee......hhhhh...eeeee.....eee..eee..ee.eeeee...eeeee...........eeee............hhhhhhhhhhhh.eee.....eee..eeeee..ee.........eee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----TRBD  PDB: A:6-110 UniProt: 364-468                                                                      -------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.11b           Exon 1.12b  PDB: A:23-87 UniProt: 381-445                        -----------------------------------------------Exon 1.13d  PDB: A:135-170          -- Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------Exon 1.12c  PDB: A:87-134 UniProt: 445-492      -------------------------------------- Transcript 1 (2)
                 1ntg A   2 PEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNISLE 172
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171

Chain B from PDB  Type:PROTEIN  Length:171
 aligned with SYYC_HUMAN | P54577 from UniProtKB/Swiss-Prot  Length:528

    Alignment length:171
                                                                                                                                                                                                  528  
                                   369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519        |- 
           SYYC_HUMAN   360 PEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS--   -
               SCOP domains d1ntgb_ B: C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS                                                                                                     SCOP domains
               CATH domains 1ntgB00 B:2-172 Nucleic acid-binding proteins                                                                                                                               CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhh.eeeeeeeeeee.......eeeeee......eeeee......hhhhh...eeeee.....eee..eee..ee.eeee.....eeee...........eeee............hhhhhhhhhhhh.eee.....eee..eeeee..ee.........eee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----TRBD  PDB: B:6-110 UniProt: 364-468                                                                      -------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.11b           Exon 1.12b  PDB: B:23-87 UniProt: 381-445                        -----------------------------------------------Exon 1.13d  PDB: B:135-170          -- Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------Exon 1.12c  PDB: B:87-134 UniProt: 445-492      -------------------------------------- Transcript 1 (2)
                 1ntg B   2 PEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNISLE 172
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171

Chain C from PDB  Type:PROTEIN  Length:171
 aligned with SYYC_HUMAN | P54577 from UniProtKB/Swiss-Prot  Length:528

    Alignment length:171
                                                                                                                                                                                                  528  
                                   369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519        |- 
           SYYC_HUMAN   360 PEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS--   -
               SCOP domains d1ntgc_ C: C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS                                                                                                     SCOP domains
               CATH domains 1ntgC00 C:2-172 Nucleic acid-binding proteins                                                                                                                               CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhh.eeeeeeeeeee.......eeeeee......eeeee......hhhhh...eeeee.....eee..eee..ee.eeeee...eeeee...........eeee............hhhhhhhhhhhh.eee.....eee..eeeee..ee.........eee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----TRBD  PDB: C:6-110 UniProt: 364-468                                                                      -------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.11b           Exon 1.12b  PDB: C:23-87 UniProt: 381-445                        -----------------------------------------------Exon 1.13d  PDB: C:135-170          -- Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------Exon 1.12c  PDB: C:87-134 UniProt: 445-492      -------------------------------------- Transcript 1 (2)
                 1ntg C   2 PEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNISLE 172
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171

Chain D from PDB  Type:PROTEIN  Length:171
 aligned with SYYC_HUMAN | P54577 from UniProtKB/Swiss-Prot  Length:528

    Alignment length:171
                                                                                                                                                                                                  528  
                                   369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519        |- 
           SYYC_HUMAN   360 PEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS--   -
               SCOP domains d1ntgd_ D: C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS                                                                                                     SCOP domains
               CATH domains 1ntgD00 D:2-172 Nucleic acid-binding proteins                                                                                                                               CATH domains
           Pfam domains (1) ----------tRNA_bind-1ntgD01 D:12-108                                                                       ---------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ----------tRNA_bind-1ntgD02 D:12-108                                                                       ---------------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) ----------tRNA_bind-1ntgD03 D:12-108                                                                       ---------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) ----------tRNA_bind-1ntgD04 D:12-108                                                                       ---------------------------------------------------------------- Pfam domains (4)
         Sec.struct. author ....hhhhh.eeeeeeeeeee.......eeeeee......eeeee......hhhhh...eeeee.....eee..eee..ee.eeee.....eeee...........eeee............hhhhhhhhhhhh.eee.....eee..eeeee..ee.........eee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----TRBD  PDB: D:6-110 UniProt: 364-468                                                                      -------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.11b           Exon 1.12b  PDB: D:23-87 UniProt: 381-445                        -----------------------------------------------Exon 1.13d  PDB: D:135-170          -- Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------Exon 1.12c  PDB: D:87-134 UniProt: 445-492      -------------------------------------- Transcript 1 (2)
                 1ntg D   2 PEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNISLE 172
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: OB-fold (1179)

Superfamily: Nucleic acid-binding proteins (590)

Family: Myf domain (20)

Protein domain: C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS (1)

Human (Homo sapiens) [TaxId: 9606] (1)

1a	d1ntga_	A:
1b	d1ntgb_	B:
1c	d1ntgc_	C:
1d	d1ntgd_	D:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Beta Barrel (4804)

Topology: OB fold (Dihydrolipoamide Acetyltransferase, E2P) (1040)

Homologous Superfamily: Nucleic acid-binding proteins (483)

Human (Homo sapiens) (27)

1a	1ntgA00	A:2-172
1b	1ntgB00	B:2-172
1c	1ntgC00	C:2-172
1d	1ntgD00	D:2-172

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: OB (224)

Family: tRNA_bind (10)

Homo sapiens (Human) (1)

1a	tRNA_bind-1ntgD01	D:12-108
1b	tRNA_bind-1ntgD02	D:12-108
1c	tRNA_bind-1ntgD03	D:12-108
1d	tRNA_bind-1ntgD04	D:12-108

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (SYYC_HUMAN | P54577)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0004812	aminoacyl-tRNA ligase activity	Catalysis of the formation of aminoacyl-tRNA from ATP, amino acid, and tRNA with the release of diphosphate and AMP.
	GO:0005153	interleukin-8 receptor binding	Interacting selectively and non-covalently with the interleukin-8 receptor.
	GO:0016874	ligase activity	Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004871	signal transducer activity	Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
	GO:0000049	tRNA binding	Interacting selectively and non-covalently with transfer RNA.
	GO:0004831	tyrosine-tRNA ligase activity	Catalysis of the reaction: L-tyrosine + ATP + tRNA(Tyr) = L-tyrosyl-tRNA(Tyr) + AMP + diphosphate + 2 H(+).
	GO:0004832	valine-tRNA ligase activity	Catalysis of the reaction: L-valine + ATP + tRNA(Val) = L-valyl-tRNA(Val) + AMP + diphosphate + 2 H(+).
biological process
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0006418	tRNA aminoacylation for protein translation	The synthesis of aminoacyl tRNA by the formation of an ester bond between the 3'-hydroxyl group of the most 3' adenosine of the tRNA, to be used in ribosome-mediated polypeptide synthesis.
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
	GO:0006437	tyrosyl-tRNA aminoacylation	The process of coupling tyrosine to tyrosyl-tRNA, catalyzed by tyrosyl-tRNA synthetase. In tRNA aminoacylation, the amino acid is first activated by linkage to AMP and then transferred to either the 2'- or the 3'-hydroxyl group of the 3'-adenosine residue of the tRNA.
	GO:0006438	valyl-tRNA aminoacylation	The process of coupling valine to valyl-tRNA, catalyzed by valyl-tRNA synthetase. In tRNA aminoacylation, the amino acid is first activated by linkage to AMP and then transferred to either the 2'- or the 3'-hydroxyl group of the 3'-adenosine residue of the tRNA.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ntg)

	Sites
(no "Sites" information available for 1ntg)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ntg)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1ntg
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SYYC_HUMAN \| P54577
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	6.1.1.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SYYC_HUMAN \| P54577
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	SYYC_HUMAN \| P54577	:	1n3l 1q11 4q93 4qbt 5thh 5thl

1n3l	CRYSTAL STRUCTURE OF THE N-FRAGMENT OF HUMAN TYROSYL-TRNA SYNTHETASE

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 4)

Exons (4, 16)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (1, 4)

Gene Ontology (21, 21)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File