1NQ6 - JenaLib

Title :   CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF XYLANASE A FROM STREPTOMYCES HALSTEDII JM8

Authors :   A. Canals, M. C. Vega, F. X. Gomis-Ruth, R. I. Santamaria, M. Coll

Date :   21 Jan 03 (Deposition) - 21 Jan 04 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.78

Chains :   Asym./Biol. Unit : A

Keywords :   Glycoside Hydrolase Family 10, Xylanase, Xylan Degradation, , Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. Canals, M. C. Vega, F. X. Gomis-Ruth, M. Diaz, R. I. Santamaria R, M. Coll
Structure Of Xylanase Xys1Delta From Streptomyces Halstedii
Acta Crystallogr. , Sect. D V. 59 1447 2003
PubMed-ID: 12876348 | Reference-DOI: 10.1107/S0907444903012629

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (2, 2)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:302
 aligned with Q59922_STRHA | Q59922 from UniProtKB/TrEMBL  Length:461

    Alignment length:302
                                    55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345  
         Q59922_STRHA    46 AGALGDAAAAKGRYFGAAVAANHLGEAAYASTLDAQFGSVTPENEMKWDAVESSRNSFSFSAADRIVSHAQSKGMKVRGHTLVWHSQLPGWVSPLAATDLRSAMNNHITQVMTHYKGKIHSWDVVNEAFQDGGSGARRSSPFQDKLGNGFIEEAFRTARTVDADAKLCYNDYNTDGQNAKSNAVYEMVKDFKQRGVPIDCVGFQSHFNSNSPVPSDFQANLQRFADLGVDVQITELDIEGSGSAQAANYTKVVNACLAVTRCTGITVWGVTDKYSWRSGGTPLLFDGDYNKKPAYDAVLAAL 347
               SCOP domains d1nq6a_ A: Xylanase A, catalytic core                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 1nq6A00 A:1-302 Glycosidases                                                                                                                                                                                                                                                                                   CATH domains
               Pfam domains --Glyco_hydro_10-1nq6A01 A:3-302                                                                                                                                                                                                                                                                               Pfam domains
         Sec.struct. author .hhhhhhhhh...eeeeeehhhhh.hhhhhhhhhhhh.eeee....hhhhhh.......hhhhhhhhhhhhhh..eeeeeeeee...........hhhhhhhhhhhhhhhhhhhh.....eeeeee.............hhhhhhhh.hhhhhhhhhhhhhh...eeeeee......hhhhhhhhhhhhhhhhhh....eeee..ee........hhhhhhhhhhh...eeeeeeeee..hhhhhhhhhhhhhhhhhh...eeeeee...hhhhh.hhhhh..........hhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1nq6 A   1 AGALGDAAAAKGRYFGAAVAANHLGEAAYASTLDAQFGSVTPENEMKWDAVESSRNSFSFSAADRIVSHAQSKGMKVRGHTLVWHSQLPGWVSPLAATDLRSAMNNHITQVMTHYKGKIHSWDVVNEAFQDGGSGARRSSPFQDKLGNGFIEEAFRTARTVDADAKLCYNDYNTDGQNAKSNAVYEMVKDFKQRGVPIDCVGFQSHFNSNSPVPSDFQANLQRFADLGVDVQITELDIEGSGSAQAANYTKVVNACLAVTRCTGITVWGVTDKYSWRSGGTPLLFDGDYNKKPAYDAVLAAL 302
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (9, 9)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (Q59922_STRHA | Q59922)

molecular function
	GO:0030246	carbohydrate binding	Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
	GO:0031176	endo-1,4-beta-xylanase activity	Catalysis of the endohydrolysis of (1->4)-beta-D-xylosidic linkages in xylans.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016798	hydrolase activity, acting on glycosyl bonds	Catalysis of the hydrolysis of any glycosyl bond.
	GO:0004553	hydrolase activity, hydrolyzing O-glycosyl compounds	Catalysis of the hydrolysis of any O-glycosyl bond.
	GO:0030247	polysaccharide binding	Interacting selectively and non-covalently with any polysaccharide, a polymer of many (typically more than 10) monosaccharide residues linked glycosidically.
biological process
	GO:0005975	carbohydrate metabolic process	The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0000272	polysaccharide catabolic process	The chemical reactions and pathways resulting in the breakdown of a polysaccharide, a polymer of many (typically more than 10) monosaccharide residues linked glycosidically.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		His A:80 - Thr A:81	[ RasMol ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1nq6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q59922_STRHA \| Q59922
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	3.2.1.8
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description