|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 6)
Asymmetric Unit (1, 6)
|
Sites (0, 0)| (no "Site" information available for 1NO1) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1NO1) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1NO1) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1NO1) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1NO1) |
Exons (0, 0)| (no "Exon" information available for 1NO1) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:67 aligned with Q38151_BPSPP | Q38151 from UniProtKB/TrEMBL Length:126 Alignment length:67 10 20 30 40 50 60 Q38151_BPSPP 1 MIEKDVVQILKAVSEFYPGRFQPDDLKGTVKAWHRVLAEYELEEIMNNLTDYAKVNKFPPTVSDLLK 67 SCOP domains d1no1a_ A: SCOP domains CATH domains -1no1A00 A:2-67 CATH domains Pfam domains ------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------- Transcript 1no1 A 1 mIEKDVVQILKAVSEFYPGRFQPDDLKGTVKAWHRVLAEYELEEImNNLTDYAKVNKFPPTVSDLLK 67 | 10 20 30 40 | 50 60 | 46-MSE 1-MSE Chain B from PDB Type:PROTEIN Length:67 aligned with Q38151_BPSPP | Q38151 from UniProtKB/TrEMBL Length:126 Alignment length:67 10 20 30 40 50 60 Q38151_BPSPP 1 MIEKDVVQILKAVSEFYPGRFQPDDLKGTVKAWHRVLAEYELEEIMNNLTDYAKVNKFPPTVSDLLK 67 SCOP domains d1no1b_ B: SCOP domains CATH domains -1no1B00 B:2-67 CATH domains Pfam domains ------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------- Transcript 1no1 B 1 mIEKDVVQILKAVSEFYPGRFQPDDLKGTVKAWHRVLAEYELEEImNNLTDYAKVNKFPPTVSDLLK 67 | 10 20 30 40 | 50 60 1-MSE 46-MSE Chain C from PDB Type:PROTEIN Length:67 aligned with Q38151_BPSPP | Q38151 from UniProtKB/TrEMBL Length:126 Alignment length:67 10 20 30 40 50 60 Q38151_BPSPP 1 MIEKDVVQILKAVSEFYPGRFQPDDLKGTVKAWHRVLAEYELEEIMNNLTDYAKVNKFPPTVSDLLK 67 SCOP domains d1no1c_ C: SCOP domains CATH domains -1no1C00 C:2-67 CATH domains Pfam domains (1) Inhibitor_G39P-1no1C01 C:1-67 Pfam domains (1) Pfam domains (2) Inhibitor_G39P-1no1C02 C:1-67 Pfam domains (2) Pfam domains (3) Inhibitor_G39P-1no1C03 C:1-67 Pfam domains (3) SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------- Transcript 1no1 C 1 mIEKDVVQILKAVSEFYPGRFQPDDLKGTVKAWHRVLAEYELEEImNNLTDYAKVNKFPPTVSDLLK 67 | 10 20 30 40 | 50 60 1-MSE 46-MSE
|
||||||||||||||||||||
SCOP Domains (1, 3)| Asymmetric Unit |
CATH Domains (1, 3)| Asymmetric Unit |
Pfam Domains (1, 3)
Asymmetric Unit
|
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1NO1)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|