|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| NMR Structure (2, 4) |
Sites (4, 4)
NMR Structure (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1NIQ) |
Cis Peptide Bonds (2, 2)
NMR Structure
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1NIQ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1NIQ) |
Exons (0, 0)| (no "Exon" information available for 1NIQ) |
Sequences/Alignments
NMR StructureChain B from PDB Type:PROTEIN Length:125 aligned with BLE_KLEPN | P13081 from UniProtKB/Swiss-Prot Length:126 Alignment length:125 11 21 31 41 51 61 71 81 91 101 111 121 BLE_KLEPN 2 TDQATPNLPSRDFDSTAAFYERLGFGIVFRDAGWMILQRGDLMLEFFAHPGLDPLASWFSCCLRLDDLAEFYRQCKSVGIQETSSGYPRIHAPELQEWGGTMAALVDPDGTLLRLIQNELLAGIS 126 SCOP domains d1niqb_ B: Bleomycin resistance protein, BRP SCOP domains CATH domains 1niqB00 B:2-126 2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript 1niq B 2 TDQATPNLPSRDFDSTAAFYERLGFGIVFRDAGWMILQRGDLMLEFFAHPGLDPLASWFSCCLRLDDLAEFYRQCKSVGIQETSSGYPRIHAPELQEWGGTMAALVDPDGTLLRLIQNELLAGIS 126 11 21 31 41 51 61 71 81 91 101 111 121 Chain C from PDB Type:PROTEIN Length:125 aligned with BLE_KLEPN | P13081 from UniProtKB/Swiss-Prot Length:126 Alignment length:125 11 21 31 41 51 61 71 81 91 101 111 121 BLE_KLEPN 2 TDQATPNLPSRDFDSTAAFYERLGFGIVFRDAGWMILQRGDLMLEFFAHPGLDPLASWFSCCLRLDDLAEFYRQCKSVGIQETSSGYPRIHAPELQEWGGTMAALVDPDGTLLRLIQNELLAGIS 126 SCOP domains d1niqc_ C: Bleomycin resistance protein, BRP SCOP domains CATH domains 1niqC00 C:2-126 2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 CATH domains Pfam domains (1) -------Glyoxalase_2-1niqC01 C:9-117 --------- Pfam domains (1) Pfam domains (2) -------Glyoxalase_2-1niqC02 C:9-117 --------- Pfam domains (2) SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript 1niq C 2 TDQATPNLPSRDFDSTAAFYERLGFGIVFRDAGWMILQRGDLMLEFFAHPGLDPLASWFSCCLRLDDLAEFYRQCKSVGIQETSSGYPRIHAPELQEWGGTMAALVDPDGTLLRLIQNELLAGIS 126 11 21 31 41 51 61 71 81 91 101 111 121
|
||||||||||||||||||||
SCOP Domains (1, 2)| NMR Structure |
CATH Domains (1, 2)| NMR Structure |
Pfam Domains (1, 2)
NMR Structure
|
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain B,C (BLE_KLEPN | P13081)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|