![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1NFH) |
(no "Site" information available for 1NFH) |
(no "SS Bond" information available for 1NFH) |
(no "Cis Peptide Bond" information available for 1NFH) |
(no "SAP(SNP)/Variant" information available for 1NFH) |
(no "PROSITE Motif" information available for 1NFH) |
(no "Exon" information available for 1NFH) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:86 aligned with ALBA2_ARCFU | O28323 from UniProtKB/Swiss-Prot Length:89 Alignment length:86 13 23 33 43 53 63 73 83 ALBA2_ARCFU 4 HVVYVGNKPVMNYVLATLTQLNEGADEVVIKARGRAISRAVDVAEIVRNRFMPGVKVKEIKIDTEELESEQGRRSNVSTIEIVLAK 89 SCOP domains d1nfha_ A: DNA-binding protein AlbA SCOP domains CATH domains 1nfhA00 A:4-89 [code=3.30.110.20, no name defined] CATH domains Pfam domains -------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------- Transcript 1nfh A 4 HVVYVGNKPVMNYVLATLTQLNEGADEVVIKARGRAISRAVDVAEIVRNRFMPGVKVKEIKIDTEELESEQGRRSNVSTIEIVLAK 89 13 23 33 43 53 63 73 83 Chain B from PDB Type:PROTEIN Length:86 aligned with ALBA2_ARCFU | O28323 from UniProtKB/Swiss-Prot Length:89 Alignment length:86 13 23 33 43 53 63 73 83 ALBA2_ARCFU 4 HVVYVGNKPVMNYVLATLTQLNEGADEVVIKARGRAISRAVDVAEIVRNRFMPGVKVKEIKIDTEELESEQGRRSNVSTIEIVLAK 89 SCOP domains d1nfhb_ B: DNA-binding protein AlbA SCOP domains CATH domains 1nfhB00 B:4-89 [code=3.30.110.20, no name defined] CATH domains Pfam domains (1) Alba-1nfhB01 B:4-67 ---------------------- Pfam domains (1) Pfam domains (2) Alba-1nfhB02 B:4-67 ---------------------- Pfam domains (2) SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------- Transcript 1nfh B 4 HVVYVGNKPVMNYVLATLTQLNEGADEVVIKARGRAISRAVDVAEIVRNRFMPGVKVKEIKIDTEELESEQGRRSNVSTIEIVLAK 89 13 23 33 43 53 63 73 83
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B (ALBA2_ARCFU | O28323)
|
|
|
|
|
|
|