|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1N6Z) |
Sites (0, 0)| (no "Site" information available for 1N6Z) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1N6Z) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1N6Z) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1N6Z) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1N6Z) |
Exons (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||||||||||||||
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:105 aligned with YMK8_YEAST | Q03759 from UniProtKB/Swiss-Prot Length:105 Alignment length:105 10 20 30 40 50 60 70 80 90 100 YMK8_YEAST 1 MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVEENN 105 SCOP domains d1n6za_ A: Hypothetical protein Yml108w SCOP domains CATH domains 1n6zA00 A:1-105 [code=3.10.20.250, no name defined] CATH domains Pfam domains DUF1892-1n6zA01 A:1-105 Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------- PROSITE Transcript 1 Exon 1.1 PDB: A:1-105 UniProt: 1-105 Transcript 1 1n6z A 1 MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVEENN 105 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (YMK8_YEAST | Q03759)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|