Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF DIMERIC MNT REPRESSOR (1-76)
 
Authors :  M. J. M. Burgering, R. Boelens, D. E. Gilbert, J. N. Breg, K. L. Knight, R. T. Sauer, R. Kaptein
Date :  28 Jun 94  (Deposition) - 30 Sep 94  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (15x)
Keywords :  Transcription Regulation (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. J. Burgering, R. Boelens, D. E. Gilbert, J. N. Breg, K. L. Knight, R. T. Sauer, R. Kaptein
Solution Structure Of Dimeric Mnt Repressor (1-76).
Biochemistry V. 33 15036 1994
PubMed-ID: 7999761  |  Reference-DOI: 10.1021/BI00254A012
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MNT REPRESSOR
    ChainsA, B
    EngineeredYES
    Organism ScientificENTEROBACTERIA PHAGE P22
    Organism Taxid10754

 Structural Features

(-) Chains, Units

  
NMR Structure (15x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1MNT)

(-) Sites  (0, 0)

(no "Site" information available for 1MNT)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1MNT)

(-) Cis Peptide Bonds  (19, 54)

NMR Structure
No.ModelResidues
11Glu A:24 -Ala A:25
21, 2, 7, 8Val A:48 -Thr A:49
31, 3, 4, 5, 15Gly A:50 -Tyr A:51
41, 4, 5, 7Phe B:9 -Arg B:10
51, 3, 6, 7, 8, 12Val B:48 -Thr B:49
62, 6, 10Phe A:9 -Arg A:10
72, 6, 8, 12, 15Asn A:53 -Asp A:54
82, 4Ala B:1 -Arg B:2
92, 3, 4, 11Asn B:53 -Asp B:54
104Ser A:46 -Pro A:47
114Asp A:54 -Ala A:55
124, 5, 8, 15Arg B:52 -Asn B:53
135Ala A:1 -Arg A:2
146, 7Arg A:52 -Asn A:53
156, 7, 11, 13, 14Gly B:50 -Tyr B:51
168Asp A:3 -Asp A:4
179, 11, 14Ser B:46 -Pro B:47
189Ala B:55 -Glu B:56
1910Lys A:44 -Pro A:45

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1MNT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1MNT)

(-) Exons   (0, 0)

(no "Exon" information available for 1MNT)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:66
 aligned with RMNT_BPP22 | P03049 from UniProtKB/Swiss-Prot  Length:83

    Alignment length:66
                                    11        21        31        41        51        61      
            RMNT_BPP22    2 ARDDPHFNFRMPMEVREKLKFRAEANGRSMNSELLQIVQDALSKPSPVTGYRNDAERLADEQSELV 67
               SCOP domains d1mnta_ A: Mnt repressor                                           SCOP domains
               CATH domains 1mntA00 A:1-66 Met repressor-like                                  CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeeeee.hhhhhhhhhhhhhh......hhhhhhhhhhhh........hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                  1mnt A  1 ARDDPHFNFRMPMEVREKLKFRAEANGRSMNSELLQIVQDALSKPSPVTGYRNDAERLADEQSELV 66
                                    10        20        30        40        50        60      

Chain B from PDB  Type:PROTEIN  Length:66
 aligned with RMNT_BPP22 | P03049 from UniProtKB/Swiss-Prot  Length:83

    Alignment length:66
                                    11        21        31        41        51        61      
            RMNT_BPP22    2 ARDDPHFNFRMPMEVREKLKFRAEANGRSMNSELLQIVQDALSKPSPVTGYRNDAERLADEQSELV 67
               SCOP domains d1mntb_ B: Mnt repressor                                           SCOP domains
               CATH domains 1mntB00 B:1-66 Met repressor-like                                  CATH domains
           Pfam domains (1) Arc-1mntB01 B:1-50                                -Repressor_Mnt-1 Pfam domains (1)
           Pfam domains (2) Arc-1mntB02 B:1-50                                -Repressor_Mnt-1 Pfam domains (2)
         Sec.struct. author ....eeeeeee.hhhhhhhhhhhhhh......hhhhhhhhhhhh........hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                  1mnt B  1 ARDDPHFNFRMPMEVREKLKFRAEANGRSMNSELLQIVQDALSKPSPVTGYRNDAERLADEQSELV 66
                                    10        20        30        40        50        60      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

NMR Structure

(-) CATH Domains  (1, 2)

NMR Structure

(-) Pfam Domains  (2, 4)

NMR Structure

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain A,B   (RMNT_BPP22 | P03049)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1mnt)
 
  Sites
(no "Sites" information available for 1mnt)
 
  Cis Peptide Bonds
    Ala A:1 - Arg A:2   [ RasMol ]  
    Ala B:1 - Arg B:2   [ RasMol ]  
    Ala B:55 - Glu B:56   [ RasMol ]  
    Arg A:52 - Asn A:53   [ RasMol ]  
    Arg B:52 - Asn B:53   [ RasMol ]  
    Asn A:53 - Asp A:54   [ RasMol ]  
    Asn B:53 - Asp B:54   [ RasMol ]  
    Asp A:3 - Asp A:4   [ RasMol ]  
    Asp A:54 - Ala A:55   [ RasMol ]  
    Glu A:24 - Ala A:25   [ RasMol ]  
    Gly A:50 - Tyr A:51   [ RasMol ]  
    Gly B:50 - Tyr B:51   [ RasMol ]  
    Lys A:44 - Pro A:45   [ RasMol ]  
    Phe A:9 - Arg A:10   [ RasMol ]  
    Phe B:9 - Arg B:10   [ RasMol ]  
    Ser A:46 - Pro A:47   [ RasMol ]  
    Ser B:46 - Pro B:47   [ RasMol ]  
    Val A:48 - Thr A:49   [ RasMol ]  
    Val B:48 - Thr B:49   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1mnt
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RMNT_BPP22 | P03049
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RMNT_BPP22 | P03049
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RMNT_BPP22 | P030491qey

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1MNT)