Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  1H NMR STUDY OF THE SOLUTION STRUCTURE OF AC-AMP2
 
Authors :  J. C. Martins, D. Maes, R. Loris, H. A. M. Pepermans, L. Wyns, R. Willem, P. Verheyden
Date :  25 Oct 95  (Deposition) - 08 Mar 96  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (26x)
Keywords :  Antifungal Antimicrobial, Chitin-Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. C. Martins, D. Maes, R. Loris, H. A. Pepermans, L. Wyns, R. Willem, P. Verheyden
H Nmr Study Of The Solution Structure Of Ac-Amp2, A Sugar Binding Antimicrobial Protein Isolated From Amaranthus Caudatus.
J. Mol. Biol. V. 258 322 1996
PubMed-ID: 8627629  |  Reference-DOI: 10.1006/JMBI.1996.0253
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ANTIMICROBIAL PEPTIDE 2
    ChainsA
    Organism CommonAMARANTH
    Organism ScientificAMARANTHUS CAUDATUS
    Organism Taxid3567
    SynonymAC-AMP2
    TissueSEED

 Structural Features

(-) Chains, Units

  
NMR Structure (26x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1MMC)

(-) Sites  (0, 0)

(no "Site" information available for 1MMC)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:4 -A:15
2A:9 -A:21
3A:14 -A:28

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1MMC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1MMC)

(-) PROSITE Motifs  (2, 2)

NMR Structure (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PLANT_C6_AMPPS60011 Plant C6 type antimicrobial peptide (AMP) signature.AMP_AMACA29-53  1A:4-28
2CHIT_BIND_I_1PS00026 Chitin recognition or binding domain signature.AMP_AMACA34-53  1A:9-28

(-) Exons   (0, 0)

(no "Exon" information available for 1MMC)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:30
 aligned with AMP_AMACA | P27275 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:30
                                    35        45        55
             AMP_AMACA   26 VGECVRGRCPSGMCCSQFGYCGKGPKYCGR 55
               SCOP domains d1mmca_ A:                     SCOP domains
               CATH domains ------------------------------ CATH domains
               Pfam domains ------------------------------ Pfam domains
         Sec.struct. author .............ee.....ee..hhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                PROSITE (1) ---PLANT_C6_AMP  PDB: A:4-28-- PROSITE (1)
                PROSITE (2) --------CHIT_BIND_I_1       -- PROSITE (2)
                 Transcript ------------------------------ Transcript
                  1mmc A  1 VGECVRGRCPSGMCCSQFGYCGKGPKYCGR 30
                                    10        20        30

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1MMC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1MMC)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (AMP_AMACA | P27275)
molecular function
    GO:0008061    chitin binding    Interacting selectively and non-covalently with chitin, a linear polysaccharide consisting of beta-(1->4)-linked N-acetyl-D-glucosamine residues.
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0042742    defense response to bacterium    Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
    GO:0050832    defense response to fungus    Reactions triggered in response to the presence of a fungus that act to protect the cell or organism.
    GO:0031640    killing of cells of other organism    Any process in an organism that results in the killing of cells of another organism, including in some cases the death of the other organism. Killing here refers to the induction of death in one cell by another cell, not cell-autonomous death due to internal or other environmental conditions.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1mmc)
 
  Sites
(no "Sites" information available for 1mmc)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1mmc)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1mmc
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AMP_AMACA | P27275
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  AMP_AMACA | P27275
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        AMP_AMACA | P272751znt 1zuv 1zwu

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1MMC)