1M9U - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF EARTHWORM FIBRINOLYTIC ENZYME COMPONENT A FROM EISENIA FETIDA

Authors :   W. Chang, D. Liang, Y. Tang

Date :   29 Jul 02 (Deposition) - 14 Aug 02 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A,B,C
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)

Keywords :   Hydrolase, Serine Protease (Elastase-Like), Fibrinolytic Enzyme (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Tang, D. Liang, T. Jiang, J. Zhang, L. Gui, W. Chang
Crystal Structure Of Earthworm Fibrinolytic Enzyme Component A: Revealing The Structural Determinants Of Its Dual Fibrinolytic Activity.
J. Mol. Biol. V. 321 57 2002
PubMed-ID: 12139933 | Reference-DOI: 10.1016/S0022-2836(02)00559-4
(for further references see the PDB file header)

Molecule 1 - EARTHWORM FIBRINOLYTIC ENZYME
	Chains	:	A, B, C
	EC Number	:	3.4.21.-
	Fragment	:	COMPONENT A
	Organism Common	:	COMMON BRANDLING WORM
	Organism Scientific	:	EISENIA FETIDA
	Organism Taxid	:	6396

		1	2	3
Asymmetric Unit	:	A	B	C
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1M9U)

(no "Site" information available for 1M9U)

Asymmetric Unit

No.	Residues
1	A:42	-	A:58
2	A:136	-	A:201
3	A:168	-	A:182
4	A:191	-	A:220
5	B:42	-	B:58
6	B:136	-	B:201
7	B:168	-	B:182
8	B:191	-	B:220
9	C:42	-	C:58
10	C:136	-	C:201
11	C:168	-	C:182
12	C:191	-	C:220

(no "Cis Peptide Bond" information available for 1M9U)

(no "SAP(SNP)/Variant" information available for 1M9U)

(no "PROSITE Motif" information available for 1M9U)

(no "Exon" information available for 1M9U)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:241
 aligned with Q8MX72_EISFE | Q8MX72 from UniProtKB/TrEMBL  Length:242

    Alignment length:241
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240 
        Q8MX72_EISFE      1 VIGGTNASPGEFPWQLSQQRQSGSWSHSCGASLLSSTSALSASHCVDGVLPNNIRVIAGLWQQSDTSGTQTANVDSYTMHENYGAGTASYSNDIAILHLATSISLGGNIQAAVLPANNNNDYAGTTCVISGWGRTDGTNNLPDILQKSSIPVITTAQCTAAMVGVGGANIWDNHICVQDPAGNTGACNGDSGGPLNCPDGGTRVVGVTSWVVSSGLGACLPDYPSVYTRVSAYLGWIGDNS  241
               SCOP domains d1m9ua_ A: Elastase                                                                                                                                                                                                                               SCOP domains
               CATH domains 1m9uA01     1m9uA02 A:28-120,A:233-242 Trypsin-like serine proteases                                           1m9uA01 A:16-27,A:121-232 Trypsin-like serine proteases                                                                 1m9uA02    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeeee...eeeeeeeee....eeeehhhhhh..hhh.eeeee...........eeeeeeeeee...............eeeee..........................eeeeee..............eeeeee..hhhhhhhhhh..........eeee................eeeee...eeeeeeeee..............eeeee...hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1m9u A   16 VIGGTNASPGEFPWQLSQQRQSGSWSHSCGASLLSSTSALSASHCVDGVLPNNIRVIAGLWQQSDTSGTQTANVDSYTMHENYGAGTASYSNDIAILHLATSISLGGNIQAAVLPANNNNDYAGTTCVISGWGRTDGTNNLPDILQKSSIPVITTAQCTAAMVGVGGANIWDNHICVQDPAGNTGACNGDSGGPLNCPDGGTRVVGVTSWVVSSGLGACLPDYPSVYTRVSAYLGWIGDNS  242
                                    25        35   ||   43        53       60C        70     || 81        91       |99       109       119       129       139       150       160       170   ||||176       186||     194       204|      215  |||| 221       231       241 
                                                 38A|                    60A||              76|                  98A|                                              147|                     173A|||          186A|               204|        217A|||                         
                                                  38B                     60B|               78                   98B                                               149                      173B||           186B                206         217B||                         
                                                                           60C                                                                                                                173C|                                            217C|                         
                                                                                                                                                                                               173D                                             217D

Chain B from PDB  Type:PROTEIN  Length:241
 aligned with Q8MX72_EISFE | Q8MX72 from UniProtKB/TrEMBL  Length:242

    Alignment length:241
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240 
        Q8MX72_EISFE      1 VIGGTNASPGEFPWQLSQQRQSGSWSHSCGASLLSSTSALSASHCVDGVLPNNIRVIAGLWQQSDTSGTQTANVDSYTMHENYGAGTASYSNDIAILHLATSISLGGNIQAAVLPANNNNDYAGTTCVISGWGRTDGTNNLPDILQKSSIPVITTAQCTAAMVGVGGANIWDNHICVQDPAGNTGACNGDSGGPLNCPDGGTRVVGVTSWVVSSGLGACLPDYPSVYTRVSAYLGWIGDNS  241
               SCOP domains d1m9ub_ B: Elastase                                                                                                                                                                                                                               SCOP domains
               CATH domains 1m9uB01     1m9uB02 B:28-120,B:233-242 Trypsin-like serine proteases                                           1m9uB01 B:16-27,B:121-232 Trypsin-like serine proteases                                                                 1m9uB02    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeeee...eeeeeeeee....eeeehhhhhh..hhh.eeeee...........eeeeeeeeee...............eeeee..........................eeeeee..............eeeeeeeehhhhhhhhhh..........eeee................eeeee...eeeeeeeee..............eeeee...hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1m9u B   16 VIGGTNASPGEFPWQLSQQRQSGSWSHSCGASLLSSTSALSASHCVDGVLPNNIRVIAGLWQQSDTSGTQTANVDSYTMHENYGAGTASYSNDIAILHLATSISLGGNIQAAVLPANNNNDYAGTTCVISGWGRTDGTNNLPDILQKSSIPVITTAQCTAAMVGVGGANIWDNHICVQDPAGNTGACNGDSGGPLNCPDGGTRVVGVTSWVVSSGLGACLPDYPSVYTRVSAYLGWIGDNS  242
                                    25        35   ||   43        53       60C        70     || 81        91       |99       109       119       129       139       150       160       170   ||||176       186||     194       204|      215  |||| 221       231       241 
                                                 38A|                    60A||              76|                  98A|                                              147|                     173A|||          186A|               204|        217A|||                         
                                                  38B                     60B|               78                   98B                                               149                      173B||           186B                206         217B||                         
                                                                           60C                                                                                                                173C|                                            217C|                         
                                                                                                                                                                                               173D                                             217D

Chain C from PDB  Type:PROTEIN  Length:241
 aligned with Q8MX72_EISFE | Q8MX72 from UniProtKB/TrEMBL  Length:242

    Alignment length:241
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240 
        Q8MX72_EISFE      1 VIGGTNASPGEFPWQLSQQRQSGSWSHSCGASLLSSTSALSASHCVDGVLPNNIRVIAGLWQQSDTSGTQTANVDSYTMHENYGAGTASYSNDIAILHLATSISLGGNIQAAVLPANNNNDYAGTTCVISGWGRTDGTNNLPDILQKSSIPVITTAQCTAAMVGVGGANIWDNHICVQDPAGNTGACNGDSGGPLNCPDGGTRVVGVTSWVVSSGLGACLPDYPSVYTRVSAYLGWIGDNS  241
               SCOP domains d1m9uc_ C: Elastase                                                                                                                                                                                                                               SCOP domains
               CATH domains 1m9uC01     1m9uC02 C:28-120,C:233-242 Trypsin-like serine proteases                                           1m9uC01 C:16-27,C:121-232 Trypsin-like serine proteases                                                                 1m9uC02    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeeee...eeeeeeeee....eeeehhhhhh..hhh.eeeee...........eeeeeeeeee...............eeeee..........................eeeeee..............eeeeee..hhhhhhhhh...........eeee................eeeee...eeeeeeeee..............eeeee...hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1m9u C   16 VIGGTNASPGEFPWQLSQQRQSGSWSHSCGASLLSSTSALSASHCVDGVLPNNIRVIAGLWQQSDTSGTQTANVDSYTMHENYGAGTASYSNDIAILHLATSISLGGNIQAAVLPANNNNDYAGTTCVISGWGRTDGTNNLPDILQKSSIPVITTAQCTAAMVGVGGANIWDNHICVQDPAGNTGACNGDSGGPLNCPDGGTRVVGVTSWVVSSGLGACLPDYPSVYTRVSAYLGWIGDNS  242
                                    25        35   ||   43        53       60C        70     || 81        91       |99       109       119       129       139       150       160       170   ||||176       186||     194       204|      215  |||| 221       231       241 
                                                 38A|                    60A||              76|                  98A|                                              147|                     173A|||          186A|               204|        217A|||                         
                                                  38B                     60B|               78                   98B                                               149                      173B||           186B                206         217B||                         
                                                                           60C                                                                                                                173C|                                            217C|                         
                                                                                                                                                                                               173D                                             217D

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Trypsin-like serine proteases (1752)

Superfamily: Trypsin-like serine proteases (1752)

Family: Eukaryotic proteases (1343)

Protein domain: Elastase (123)

Worm (Eisenia fetida) [TaxId: 6396] (1)

1a	d1m9ua_	A:
1b	d1m9ub_	B:
1c	d1m9uc_	C:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Beta Barrel (4804)

Topology: Thrombin, subunit H (1535)

Homologous Superfamily: Trypsin-like serine proteases (1488)

Common brandling worm (Eisenia fetida) (2)

1a	1m9uA02	A:28-120,A:233-242
1b	1m9uB02	B:28-120,B:233-242
1c	1m9uC02	C:28-120,C:233-242
1d	1m9uA01	A:16-27,A:121-232
1e	1m9uB01	B:16-27,B:121-232
1f	1m9uC01	C:16-27,C:121-232

(no "Pfam Domain" information available for 1M9U)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C (Q8MX72_EISFE | Q8MX72)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
	GO:0008236	serine-type peptidase activity	Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1m9u)

	Sites
(no "Sites" information available for 1m9u)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1m9u)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1m9u
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q8MX72_EISFE \| Q8MX72
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	3.4.21.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	Q8MX72_EISFE \| Q8MX72
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1M9U)

(no "Related Entries Specified in the PDB File" available for 1M9U)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (12, 12)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 3)

CATH Domains (1, 6)

Pfam Domains (0, 0)

Gene Ontology (7, 7)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File