|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric Unit (2, 4) Biological Unit 1 (2, 16) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1LXJ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1LXJ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1LXJ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1LXJ) |
Exons (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:104 aligned with ECM15_YEAST | P35195 from UniProtKB/Swiss-Prot Length:104 Alignment length:104 10 20 30 40 50 60 70 80 90 100 ECM15_YEAST 1 MPKIFCLADVCMVPIGTDSASISDFVALIEKKIRESPLKSTLHSAGTTIEGPWDDVMGLIGEIHEYGHEKGYVRVHTDIRVGTRTDKHQTAQDKIDVVLKKISQ 104 SCOP domains d1lxja_ A: Hypothetical protein YB1001C SCOP domains CATH domains -1lxjA00 A:2-104 [code=3.30.70.930, no name defined] CATH domains Pfam domains -------DUF77-1lxjA01 A:8-99 ----- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------- PROSITE Transcript 1 Exon 1.1 PDB: A:1-104 UniProt: 1-104 Transcript 1 1lxj A 1 mPKIFCLADVCmVPIGTDSASISDFVALIEKKIRESPLKSTLHSAGTTIEGPWDDVmGLIGEIHEYGHEKGYVRVHTDIRVGTRTDKHQTAQDKIDVVLKKISQ 104 | 10 | 20 30 40 50 | 60 70 80 90 100 | 12-MSE 57-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A (ECM15_YEAST | P35195)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|