1LOE - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   X-RAY CRYSTAL STRUCTURE DETERMINATION AND REFINEMENT AT 1.9 ANGSTROMS RESOLUTION OF ISOLECTIN I FROM THE SEEDS OF LATHYRUS OCHRUS

Authors :   Y. Bourne, C. Cambillau

Date :   27 Jan 93 (Deposition) - 30 Apr 94 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B,C,D  (1x)
Biol. Unit 2: C,D  (1x)
Biol. Unit 3: A,B  (1x)

Keywords :   Lectin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Bourne, C. Abergel, C. Cambillau, M. Frey, P. Rouge, J. C. Fontecilla-Camps
X-Ray Crystal Structure Determination And Refinement At 1. 9 A Resolution Of Isolectin I From The Seeds Of Lathyrus Ochrus.
J. Mol. Biol. V. 214 571 1990
PubMed-ID: 2380988 | Reference-DOI: 10.1016/0022-2836(90)90199-V

Molecule 1 - LEGUME ISOLECTIN I (ALPHA CHAIN)
	Chains	:	A, C
	Engineered	:	YES
	Organ	:	SEED
	Organism Common	:	YELLOW-FLOWERED PEA
	Organism Scientific	:	LATHYRUS OCHRUS
	Organism Taxid	:	3858

Molecule 2 - LEGUME ISOLECTIN I (BETA CHAIN)
	Chains	:	B, D
	Engineered	:	YES
	Organ	:	SEED
	Organism Common	:	YELLOW-FLOWERED PEA
	Organism Scientific	:	LATHYRUS OCHRUS
	Organism Taxid	:	3858

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B	C	D
Biological Unit 2 (1x)	:			C	D
Biological Unit 3 (1x)	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 4)

No.	Name	Count	Type	Full Name
1	CA	2	Ligand/Ion	CALCIUM ION
2	MN	2	Ligand/Ion	MANGANESE (II) ION

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION
2	MN	-1	Ligand/Ion	MANGANESE (II) ION

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION
2	MN	-1	Ligand/Ion	MANGANESE (II) ION

Biological Unit 3 (0, 0)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION
2	MN	-1	Ligand/Ion	MANGANESE (II) ION

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP A:121 , PHE A:123 , ASN A:125 , ASP A:129 , HOH A:750 , HOH A:751	BINDING SITE FOR RESIDUE CA A 227
2	AC2	SOFTWARE	GLU A:119 , ASP A:121 , ASP A:129 , HIS A:136 , HOH A:752 , HOH A:753	BINDING SITE FOR RESIDUE MN A 228
3	AC3	SOFTWARE	ASP C:121 , PHE C:123 , ASN C:125 , ASP C:129 , HOH C:768 , HOH C:769	BINDING SITE FOR RESIDUE CA C 457
4	AC4	SOFTWARE	GLU C:119 , ASP C:121 , ASP C:129 , HIS C:136 , HOH C:770 , HOH C:771	BINDING SITE FOR RESIDUE MN C 458

(no "SS Bond" information available for 1LOE)

Asymmetric Unit

No.	Residues
1	Ala A:80	-	Asp A:81
2	Ala C:80	-	Asp C:81

Asymmetric Unit (3, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_LECB_LATOC_001 *	Q	16	P	LECB_LATOC	---	---	A/C	Q	16	P
2	UniProt	VAR_LECB_LATOC_002 *	S	66	A	LECB_LATOC	---	---	A/C	S	66	A
3	UniProt	VAR_LECB_LATOC_003 *	A	168	G	LECB_LATOC	---	---	A/C	A	168	G
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (3, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_LECB_LATOC_001 *	Q	16	P	LECB_LATOC	---	---	A/C	Q	16	P
2	UniProt	VAR_LECB_LATOC_002 *	S	66	A	LECB_LATOC	---	---	A/C	S	66	A
3	UniProt	VAR_LECB_LATOC_003 *	A	168	G	LECB_LATOC	---	---	A/C	A	168	G
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_LECB_LATOC_001 *	Q	16	P	LECB_LATOC	---	---	C	Q	16	P
2	UniProt	VAR_LECB_LATOC_002 *	S	66	A	LECB_LATOC	---	---	C	S	66	A
3	UniProt	VAR_LECB_LATOC_003 *	A	168	G	LECB_LATOC	---	---	C	A	168	G
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_LECB_LATOC_001 *	Q	16	P	LECB_LATOC	---	---	A	Q	16	P
2	UniProt	VAR_LECB_LATOC_002 *	S	66	A	LECB_LATOC	---	---	A	S	66	A
3	UniProt	VAR_LECB_LATOC_003 *	A	168	G	LECB_LATOC	---	---	A	A	168	G
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LECTIN_LEGUME_ALPHA	PS00308	Legume lectins alpha-chain signature.	LEC1_LATOC	16-25	2	B:16-25 D:16-25
2	LECTIN_LEGUME_BETA	PS00307	Legume lectins beta-chain signature.	LECB_LATOC	116-122	2	A:116-122 C:116-122

Biological Unit 1 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LECTIN_LEGUME_ALPHA	PS00308	Legume lectins alpha-chain signature.	LEC1_LATOC	16-25	2	B:16-25 D:16-25
2	LECTIN_LEGUME_BETA	PS00307	Legume lectins beta-chain signature.	LECB_LATOC	116-122	2	A:116-122 C:116-122

Biological Unit 2 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LECTIN_LEGUME_ALPHA	PS00308	Legume lectins alpha-chain signature.	LEC1_LATOC	16-25	1	- D:16-25
2	LECTIN_LEGUME_BETA	PS00307	Legume lectins beta-chain signature.	LECB_LATOC	116-122	1	- C:116-122

Biological Unit 3 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LECTIN_LEGUME_ALPHA	PS00308	Legume lectins alpha-chain signature.	LEC1_LATOC	16-25	1	B:16-25 -
2	LECTIN_LEGUME_BETA	PS00307	Legume lectins beta-chain signature.	LECB_LATOC	116-122	1	A:116-122 -

(no "Exon" information available for 1LOE)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:180
 aligned with LECB_LATOC | P04122 from UniProtKB/Swiss-Prot  Length:181

    Alignment length:180
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180
           LECB_LATOC     1 TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWKLQNGKEANVVIAFNAATNVLTVSLTYP 180
               SCOP domains d1loe.1 A:,B: Legume lectin                                                                                                                                                          SCOP domains
               CATH domains 1loeA00 A:1-180  [code=2.60.120.200, no name defined]                                                                                                                                CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .................eeeee..................eeeeee...ee..............................eeeeeeee.......hhhhh........hhhhh.eeeeee..............eeeeee......eeee............................. Sec.struct. author
                 SAPs(SNPs) ---------------P-------------------------------------------------A-----------------------------------------------------------------------------------------------------G------------ SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------LECTIN_---------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1loe A   1 TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEANVVIAFNAATNVLTVSLTYP 180
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180

Chain B from PDB  Type:PROTEIN  Length:46
 aligned with LEC1_LATOC | P12306 from UniProtKB/Swiss-Prot  Length:53

    Alignment length:46
                                    11        21        31        41      
           LEC1_LATOC     2 TSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSWFFHSELA  47
               SCOP domains d1loe.1 A:,B: Legume lectin                    SCOP domains
               CATH domains ---------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhh...eeeeeeeee.................... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------- SAPs(SNPs)
                    PROSITE --------------LECTIN_LEG---------------------- PROSITE
                 Transcript ---------------------------------------------- Transcript
                 1loe B   2 TSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSWYFHSELA  47
                                    11        21        31        41

Chain C from PDB  Type:PROTEIN  Length:181
 aligned with LECB_LATOC | P04122 from UniProtKB/Swiss-Prot  Length:181

    Alignment length:181
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180 
           LECB_LATOC     1 TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWKLQNGKEANVVIAFNAATNVLTVSLTYPN 181
               SCOP domains d1loe.2 C:,D: Legume lectin                                                                                                                                                           SCOP domains
               CATH domains 1loeC00 C:1-181  [code=2.60.120.200, no name defined]                                                                                                                                 CATH domains
           Pfam domains (1) -Lectin_legB-1loeC01 C:2-181                                                                                                                                                          Pfam domains (1)
           Pfam domains (2) -Lectin_legB-1loeC02 C:2-181                                                                                                                                                          Pfam domains (2)
         Sec.struct. author .................eeeee..................eeeeee...ee..............................eeeeeeee.......hhhhh..............eeeeee..............eeeeee......eeee.............................. Sec.struct. author
                 SAPs(SNPs) ---------------P-------------------------------------------------A-----------------------------------------------------------------------------------------------------G------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------LECTIN_----------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1loe C   1 TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEANVVIAFNAATNVLTVSLTYPN 181
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180

Chain D from PDB  Type:PROTEIN  Length:47
 aligned with LEC1_LATOC | P12306 from UniProtKB/Swiss-Prot  Length:53

    Alignment length:47
                                    10        20        30        40       
           LEC1_LATOC     1 ETSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSWFFHSELA  47
               SCOP domains d1loe.2 C:,D: Legume lectin                     SCOP domains
               CATH domains ----------------------------------------------- CATH domains
           Pfam domains (1) Lectin_legB-1loeD01 D:1-43                 ---- Pfam domains (1)
           Pfam domains (2) Lectin_legB-1loeD02 D:1-43                 ---- Pfam domains (2)
         Sec.struct. author ..........hhhhhh..eeeeeeeee.................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------LECTIN_LEG---------------------- PROSITE
                 Transcript ----------------------------------------------- Transcript
                 1loe D   1 ETSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSWYFHSELA  47
                                    10        20        30        40

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Concanavalin A-like lectins/glucanases (797)

Superfamily: Concanavalin A-like lectins/glucanases (797)

Family: Legume lectins (238)

Protein domain: Legume lectin (110)

Lathyrus ochrus, isolectin I [TaxId: 3858] (7)

1a	d1loe.1	A:,B:
1b	d1loe.2	C:,D:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Jelly Rolls (1293)

Homologous Superfamily: [code=2.60.120.200, no name defined] (421)

Yellow-flowered pea (Lathyrus ochrus) (8)

1a	1loeC00	C:1-181
1b	1loeA00	A:1-180

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Concanavalin (293)

Family: Lectin_legB (93)

Lathyrus ochrus (Yellow-flowered pea) (6)

1a	Lectin_legB-1loeD01	D:1-43
1b	Lectin_legB-1loeD02	D:1-43
1c	Lectin_legB-1loeC01	C:2-181
1d	Lectin_legB-1loeC02	C:2-181

Asymmetric Unit(hide GO term definitions)

Chain A,C (LECB_LATOC | P04122)


GO:0030246	carbohydrate binding	Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
GO:0005537	mannose binding	Interacting selectively and non-covalently with mannose, a monosaccharide hexose, stereoisomeric with glucose, that occurs naturally only in polymerized forms called mannans.
GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.

Chain B,D (LEC1_LATOC | P12306)

molecular function
	GO:0030246		carbohydrate binding		Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
	GO:0005537		mannose binding		Interacting selectively and non-covalently with mannose, a monosaccharide hexose, stereoisomeric with glucose, that occurs naturally only in polymerized forms called mannans.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala A:80 - Asp A:81	[ RasMol ]
		Ala C:80 - Asp C:81	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1loe
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	LEC1_LATOC \| P12306
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	LECB_LATOC \| P04122
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	LEC1_LATOC \| P12306
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	LECB_LATOC \| P04122
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	LEC1_LATOC \| P12306	:	1loa 1lob 1loc 1lod 1lof 1log
	LECB_LATOC \| P04122	:	1lgb 1lgc 1loa 1lob 1loc 1lod 1lof 1log

(no "Related Entries Specified in the PDB File" available for 1LOE)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 6)

PROSITE Motifs (2, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 4)

Gene Ontology (3, 5)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File