|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 6)| Asymmetric/Biological Unit (3, 6) |
Sites (6, 6)
Asymmetric Unit (6, 6)
|
SS Bonds (14, 14)
Asymmetric/Biological Unit
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1S6B) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1S6B) |
PROSITE Motifs (2, 4)
Asymmetric/Biological Unit (2, 4)
|
||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1S6B) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:119 aligned with PA2B1_NAJSG | P60043 from UniProtKB/Swiss-Prot Length:126 Alignment length:119 17 27 37 47 57 67 77 87 97 107 117 PA2B1_NAJSG 8 NTYQFKNMIQCTVPKRSWWDFADYGCYCGRGGSGTPIDDLDRCCQVHDNCYNSAREQGGCRPKQKTYSYECKAGTLSCSGSNNSCAATVCDCDRLAAICFAGAPYNDNNYNIDLKARCQ 126 SCOP domains d1s6ba_ A: Snake phospholipase A2 SCOP domains CATH domains 1s6bA00 A:1-120 Phospholipase A2 CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------PA2_HIS --------------------------------------PA2_ASP -------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript 1s6b A 1 NTYQFKNMIQCTVPKRSWWDFADYGCYCGRGGSGTPIDDLDRCCQVHDNCYNSAREQGGCRPKQKTYSYECKAGTLSCSGSNNSCAATVCDCDRLAAICFAGAPYNDNNYNIDLKARCQ 120 10 || 21 31 41 51 61 71 81 91 101 111 15| 17 Chain B from PDB Type:PROTEIN Length:119 aligned with PA2A2_NAJSG | P60044 from UniProtKB/Swiss-Prot Length:126 Alignment length:119 17 27 37 47 57 67 77 87 97 107 117 PA2A2_NAJSG 8 NRWQFKNMISCTVPSRSWWDFADYGCYCGRGGSGTPVDDLDRCCQVHDNCYNEAEKISGCNPRFRTYSYECTAGTLTCTGRNNACAASVCDCDRLAAICFAGAPYNDNNYNIDLQARCN 126 SCOP domains d1s6bb_ B: Snake phospholipase A2 SCOP domains CATH domains 1s6bB00 B:1-120 Phospholipase A2 CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (2) ------------------------------------------PA2_HIS --------------------------------------PA2_ASP -------------------- PROSITE (2) Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript 1s6b B 1 NRWQFKNMISCTVPSRSWWDFADYGCYCGRGGSGTPVDDLDRCCQVHDNCYNEAEKISGCNPRFRTYSYECTAGTLTCTGRNNACAASVCDCDRLAAICFAGAPYNDNNYNIDLQARCN 120 10 || 21 31 41 51 61 71 81 91 101 111 15| 17
|
||||||||||||||||||||
SCOP Domains (2, 2)| Asymmetric/Biological Unit |
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1S6B) |
Gene Ontology (7, 14)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (PA2B1_NAJSG | P60043)
Chain B (PA2A2_NAJSG | P60044)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|