1LCL - JenaLib

Title :   CHARCOT-LEYDEN CRYSTAL PROTEIN

Authors :   K. R. Acharya, D. D. Leonidas

Date :   18 Jan 96 (Deposition) - 11 Jan 97 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym. Unit : A
Biol. Unit 1: A  (2x)

Keywords :   Charcot-Leyden Crystal Protein, Serine Esterase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   D. D. Leonidas, B. L. Elbert, Z. Zhou, H. Leffler, S. J. Ackerman, K. R. Acharya
Crystal Structure Of Human Charcot-Leyden Crystal Protein, An Eosinophil Lysophospholipase, Identifies It As A New Member Of The Carbohydrate-Binding Family Of Galectins.
Structure V. 3 1379 1995
PubMed-ID: 8747464 | Reference-DOI: 10.1016/S0969-2126(01)00275-1
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (1, 1)

Exons (4, 4)

Asymmetric Unit (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000221804	1	ENSE00001477760	chr19:40228668-40228578	91	LEG10_HUMAN	1-5	5	1	A:2-5	4
1.2	ENST00000221804	2	ENSE00000877644	chr19:40225713-40225637	77	LEG10_HUMAN	6-31	26	1	A:6-31	26
1.3	ENST00000221804	3	ENSE00000706193	chr19:40225133-40224923	211	LEG10_HUMAN	31-101	71	1	A:31-101	71
1.4	ENST00000221804	4	ENSE00000877645	chr19:40222145-40221896	250	LEG10_HUMAN	102-142	41	1	A:102-142	41

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:141
 aligned with LEG10_HUMAN | Q05315 from UniProtKB/Swiss-Prot  Length:142

    Alignment length:141
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141 
          LEG10_HUMAN     2 SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR 142
               SCOP domains d1lcla_ A: Charcot-Leyden crystal (CLC) protein                                                                                               SCOP domains
               CATH domains 1lclA00 A:2-142  [code=2.60.120.200, no name defined]                                                                                         CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.......eeeeeeee...hhh..eeeeeee........eeeeeeee...eeeee..........eee.........eeeeeeee...eeeeee..eeeeeee....hhh..eeeeee.eeeeeeee..... Sec.struct. author
                 SAPs(SNPs) --------------------------V------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----GALECTIN  PDB: A:6-138 UniProt: 6-138                                                                                                ---- PROSITE
           Transcript 1 (1) 1.1 Exon 1.2  PDB: A:6-31     ----------------------------------------------------------------------Exon 1.4  PDB: A:102-142 UniProt: 102-142 Transcript 1 (1)
           Transcript 1 (2) -----------------------------Exon 1.3  PDB: A:31-101 UniProt: 31-101                                ----------------------------------------- Transcript 1 (2)
                 1lcl A   2 SLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR 142
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (11, 11)

Asymmetric Unit(hide GO term definitions)

Chain A (LEG10_HUMAN | Q05315)

molecular function
	GO:0030246	carbohydrate binding	Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
	GO:0097153	cysteine-type endopeptidase activity involved in apoptotic process	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile, and contributing to the apoptotic process.
	GO:0004622	lysophospholipase activity	Catalysis of the reaction: 2-lysophosphatidylcholine + H2O = glycerophosphocholine + a carboxylate.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0070231	T cell apoptotic process	Any apoptotic process in a T cell, a type of lymphocyte whose defining characteristic is the expression of a T cell receptor complex.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:0002667	regulation of T cell anergy	Any process that modulates the frequency, rate, or extent of T cell anergy.
	GO:0002724	regulation of T cell cytokine production	Any process that modulates the frequency, rate, or extent of T cell cytokine production.
	GO:0046006	regulation of activated T cell proliferation	Any process that modulates the frequency, rate or extent of activated T cell proliferation.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1lcl)

	Sites
(no "Sites" information available for 1lcl)

	Cis Peptide Bonds
		Val A:6 - Pro A:7	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1lcl
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	LEG10_HUMAN \| Q05315
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.1.5
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	LEG10_HUMAN \| Q05315
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description