|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 3)
|
Asymmetric Unit (3, 3)
|
(no "SS Bond" information available for 1L5P) |
(no "Cis Peptide Bond" information available for 1L5P) |
(no "SAP(SNP)/Variant" information available for 1L5P) |
Asymmetric Unit (1, 3)
|
(no "Exon" information available for 1L5P) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:93 aligned with FER_TRIVA | P21149 from UniProtKB/Swiss-Prot Length:100 Alignment length:93 67 66 | 18 28 38 48 58 |67 77 87 97 FER_TRIVA 9 GTITAVKGGVKKQLKFEDDQTLFTVLTEAGLMSADDTCQGNKACGKCICKHVSGKVAA-EDDEKEFLEDQPANARLACAITLSGENDGAVFEL 100 SCOP domains d1l5pa_ A: 2Fe-2S ferredoxin SCOP domains CATH domains 1l5pA00 A:1-93 [code=3.10.20.30, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE 2FE2S_FER_2 PDB: A:1-93 UniProt: 9-100 PROSITE Transcript --------------------------------------------------------------------------------------------- Transcript 1l5p A 1 GTITAVKGGVKKQLKFEDDQTLFTVLTEAGLMSADDTCQGNKACGKCICKHVSGKVAAAEDDEKEFLEDQPANARLACAITLSGENDGAVFEL 93 10 20 30 40 50 60 70 80 90 Chain B from PDB Type:PROTEIN Length:93 aligned with FER_TRIVA | P21149 from UniProtKB/Swiss-Prot Length:100 Alignment length:93 67 66 | 18 28 38 48 58 |67 77 87 97 FER_TRIVA 9 GTITAVKGGVKKQLKFEDDQTLFTVLTEAGLMSADDTCQGNKACGKCICKHVSGKVAA-EDDEKEFLEDQPANARLACAITLSGENDGAVFEL 100 SCOP domains d1l5pb_ B: 2Fe-2S ferredoxin SCOP domains CATH domains 1l5pB00 B:1-93 [code=3.10.20.30, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE 2FE2S_FER_2 PDB: B:1-93 UniProt: 9-100 PROSITE Transcript --------------------------------------------------------------------------------------------- Transcript 1l5p B 1 GTITAVKGGVKKQLKFEDDQTLFTVLTEAGLMSADDTCQGNKACGKCICKHVSGKVAAAEDDEKEFLEDQPANARLACAITLSGENDGAVFEL 93 10 20 30 40 50 60 70 80 90 Chain C from PDB Type:PROTEIN Length:93 aligned with FER_TRIVA | P21149 from UniProtKB/Swiss-Prot Length:100 Alignment length:93 67 66 | 18 28 38 48 58 |67 77 87 97 FER_TRIVA 9 GTITAVKGGVKKQLKFEDDQTLFTVLTEAGLMSADDTCQGNKACGKCICKHVSGKVAA-EDDEKEFLEDQPANARLACAITLSGENDGAVFEL 100 SCOP domains d1l5pc_ C: 2Fe-2S ferredoxin SCOP domains CATH domains 1l5pC00 C:1-93 [code=3.10.20.30, no name defined] CATH domains Pfam domains (1) -----Fer2-1l5pC01 C:6-83 ---------- Pfam domains (1) Pfam domains (2) -----Fer2-1l5pC02 C:6-83 ---------- Pfam domains (2) Pfam domains (3) -----Fer2-1l5pC03 C:6-83 ---------- Pfam domains (3) SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE 2FE2S_FER_2 PDB: C:1-93 UniProt: 9-100 PROSITE Transcript --------------------------------------------------------------------------------------------- Transcript 1l5p C 1 GTITAVKGGVKKQLKFEDDQTLFTVLTEAGLMSADDTCQGNKACGKCICKHVSGKVAAAEDDEKEFLEDQPANARLACAITLSGENDGAVFEL 93 10 20 30 40 50 60 70 80 90
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B,C (FER_TRIVA | P21149)
|
|
|
|
|
|
|