|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (1, 2) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (1, 1)
Asymmetric Unit
|
||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1L3P) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1L3P) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1L3P) |
Exons (0, 0)| (no "Exon" information available for 1L3P) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:102 aligned with MPA5B_PHLPR | Q40963 from UniProtKB/Swiss-Prot Length:284 Alignment length:102 159 169 179 189 199 209 219 229 239 249 MPA5B_PHLPR 150 IPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQ 251 SCOP domains d1l3pa_ A: Functional domain of pollen allergen Phl P 5b SCOP domains CATH domains 1l3pA00 A:150-251 [code=1.20.120.320, no name defined] CATH domains Pfam domains Pollen_allerg_2-1l3pA01 A:150-251 Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------ Transcript 1l3p A 150 IPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKETTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQ 251 159 169 179 189 199 209 219 229 239 249
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A (MPA5B_PHLPR | Q40963)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|