Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE PROTEASE DOMAIN OF AN ATP-INDEPENDENT HEAT SHOCK PROTEASE HTRA
 
Authors :  D. Y. Kim, D. R. Kim, S. C. Ha, N. K. Lokanath, H. Y. Hwang, K. K. Kim
Date :  18 Feb 02  (Deposition) - 01 Apr 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Hydrolase, Serine Proteinase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Y. Kim, D. R. Kim, S. C. Ha, N. K. Lokanath, C. J. Lee, H. Y. Hwang, K. K. Kim
Crystal Structure Of The Protease Domain Of A Heat-Shock Protein Htra From Thermotoga Maritima
J. Biol. Chem. V. 278 6543 2003
PubMed-ID: 12458220  |  Reference-DOI: 10.1074/JBC.M208148200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HEAT SHOCK PROTEASE HTRA
    Chains: A, B
    EC Number: 3.4.21.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET-22B
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: PROTEASE DOMAIN
    Organism Scientific: THERMOTOGA MARITIMA
    Organism Taxid: 2336
    Synonym: HEAT SHOCK SERINE PROTEASE, PERIPLASMIC

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1L1J)

(-) Sites  (0, 0)

(no "Site" information available for 1L1J)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1L1J)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Asn A:226 -Pro A:227

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1L1J)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1L1J)

(-) Exons   (0, 0)

(no "Exon" information available for 1L1J)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:226
 aligned with Q9WZ41_THEMA | Q9WZ41 from UniProtKB/TrEMBL  Length:459

    Alignment length:228
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243        
         Q9WZ41_THEMA    24 DYESPIVNVVEACAPAVVKIDVVKTVKTSFFDPYFEQFFKKWFGELPPGFERQVASLGSGFIFDPEGYILTNYHVVGGADNITVTMLDGSKYDAEYIGGDEELDIAVIKIKASDKKFPYLEFGDSDKVKIGEWAIAIGNPLGFQHTVTVGVVSATNRRIPKPDGSGYYVGLIQTDAAINPGNSGGPLLNIHGEVIGINTAIVNPQEAVNLGFAIPINTVKKFLDTILT 251
               SCOP domains d1l1ja_ A: Protease Do (D  egP, HtrA), catalytic domain                                                                                                                                                                              SCOP domains
               CATH domains 1l1jA01 A:24-143 Trypsin-  like serine proteases                                                                        1l1jA02 A:144-251 Trypsin-like serine proteases                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhh..eeeeeee..--....hhhhhhhhhhhh.....hhhhheeeeeeeeeee...eeeeehhhhh.....eee.....eee....eee....eeeee...........ee.hhhhh....eeeeee.......eeeeeeeeeeeeeee......eeeeeeee...........eee....eeeeee............eeeeehhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1l1j A  24 DYESPIVNVVEACAPAVVKIDVVKT--TSFFDPYFEQFFKKWFGELPPGFERQVASLGSGFIFDPEGYILTNYHVVGGADNITVTMLDGSKYDAEYIGGDEELDIAVIKIKASDKKFPYLEFGDSDKVKIGEWAIAIGNPLGFQHTVTVGVVSATNRRIPKPDGSGYYVGLIQTDAAINPGNSGGPLLNIHGEVIGINTAIVNPQEAVNLGFAIPINTVKKFLDTILT 251
                                    33        43    |  |53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243        
                                                   48 51                                                                                                                                                                                                        


Chain B from PDB  Type:PROTEIN  Length:226
 aligned with Q9WZ41_THEMA | Q9WZ41 from UniProtKB/TrEMBL  Length:459

    Alignment length:228
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243        
         Q9WZ41_THEMA    24 DYESPIVNVVEACAPAVVKIDVVKTVKTSFFDPYFEQFFKKWFGELPPGFERQVASLGSGFIFDPEGYILTNYHVVGGADNITVTMLDGSKYDAEYIGGDEELDIAVIKIKASDKKFPYLEFGDSDKVKIGEWAIAIGNPLGFQHTVTVGVVSATNRRIPKPDGSGYYVGLIQTDAAINPGNSGGPLLNIHGEVIGINTAIVNPQEAVNLGFAIPINTVKKFLDTILT 251
               SCOP domains d1l1jb_ B: Protease Do (D  egP, HtrA), catalytic domain                                                                                                                                                                              SCOP domains
               CATH domains 1l1jB01 B:24-143 Trypsin-  like serine proteases                                                                        1l1jB02 B:144-251 Trypsin-like serine proteases                                                              CATH domains
           Pfam domains (1) ---------------------------------------------------------Trypsin_2-1l1jB01 B:81-220                                                                                                                  ------------------------------- Pfam domains (1)
           Pfam domains (2) ---------------------------------------------------------Trypsin_2-1l1jB02 B:81-220                                                                                                                  ------------------------------- Pfam domains (2)
         Sec.struct. author ...hhhhhhhhhhh..eeeeeee..--......hhhhhhhhhh..........eeeeeeeee.....eeeehhhhhh.....eee.....eee.eeeee......eeee...........ee.hhhhh....eeeeee.......eeeeeeeeeeeeeee......eeeeeeee...........eee....eeeeeee...........eeeeehhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1l1j B  24 DYESPIVNVVEACAPAVVKIDVVKT--TSFFDPYFEQFFKKWFGELPPGFERQVASLGSGFIFDPEGYILTNYHVVGGADNITVTMLDGSKYDAEYIGGDEELDIAVIKIKASDKKFPYLEFGDSDKVKIGEWAIAIGNPLGFQHTVTVGVVSATNRRIPKPDGSGYYVGLIQTDAAINPGNSGGPLLNIHGEVIGINTAIVNPQEAVNLGFAIPINTVKKFLDTILT 251
                                    33        43    |  |53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243        
                                                   48 51
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: Peptidase_PA (797)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q9WZ41_THEMA | Q9WZ41)
molecular function
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1l1j)
 
  Sites
(no "Sites" information available for 1l1j)
 
  Cis Peptide Bonds
    Asn A:226 - Pro A:227   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1l1j
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9WZ41_THEMA | Q9WZ41
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9WZ41_THEMA | Q9WZ41
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1L1J)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1L1J)