1KYM - JenaLib

Theoretical Model

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:55
 aligned with MSCL_ECO57 | P0A743 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:83
                                    23        33        43        53        63        73        83        93   
            MSCL_ECO57   14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAI 96
               SCOP domains ----------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............................----------------------------......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------- Transcript
                  1kym A 14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMP----------------------------VMHYGVFIQNVFDFLIVAFAIFMAI 96
                                    23        33        43         -         -        73        83        93   
                                                        43                           72

Chain A from PDB  Type:PROTEIN  Length:55
 aligned with MSCL_ECOLI | P0A742 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:83
                                    23        33        43        53        63        73        83        93   
            MSCL_ECOLI   14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAI 96
               SCOP domains ----------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............................----------------------------......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------- Transcript
                  1kym A 14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMP----------------------------VMHYGVFIQNVFDFLIVAFAIFMAI 96
                                    23        33        43         -         -        73        83        93   
                                                        43                           72

Chain B from PDB  Type:PROTEIN  Length:55
 aligned with MSCL_ECO57 | P0A743 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:83
                                    23        33        43        53        63        73        83        93   
            MSCL_ECO57   14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAI 96
               SCOP domains ----------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............................----------------------------......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------- Transcript
                  1kym B 14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMP----------------------------VMHYGVFIQNVFDFLIVAFAIFMAI 96
                                    23        33        43         -         -        73        83        93   
                                                        43                           72

Chain B from PDB  Type:PROTEIN  Length:55
 aligned with MSCL_ECOLI | P0A742 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:83
                                    23        33        43        53        63        73        83        93   
            MSCL_ECOLI   14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAI 96
               SCOP domains ----------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............................----------------------------......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------- Transcript
                  1kym B 14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMP----------------------------VMHYGVFIQNVFDFLIVAFAIFMAI 96
                                    23        33        43         -         -        73        83        93   
                                                        43                           72

Chain C from PDB  Type:PROTEIN  Length:55
 aligned with MSCL_ECO57 | P0A743 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:83
                                    23        33        43        53        63        73        83        93   
            MSCL_ECO57   14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAI 96
               SCOP domains ----------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............................----------------------------......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------- Transcript
                  1kym C 14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMP----------------------------VMHYGVFIQNVFDFLIVAFAIFMAI 96
                                    23        33        43         -         -        73        83        93   
                                                        43                           72

Chain C from PDB  Type:PROTEIN  Length:55
 aligned with MSCL_ECOLI | P0A742 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:83
                                    23        33        43        53        63        73        83        93   
            MSCL_ECOLI   14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAI 96
               SCOP domains ----------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............................----------------------------......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------- Transcript
                  1kym C 14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMP----------------------------VMHYGVFIQNVFDFLIVAFAIFMAI 96
                                    23        33        43         -         -        73        83        93   
                                                        43                           72

Chain D from PDB  Type:PROTEIN  Length:55
 aligned with MSCL_ECO57 | P0A743 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:83
                                    23        33        43        53        63        73        83        93   
            MSCL_ECO57   14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAI 96
               SCOP domains ----------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............................----------------------------......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------- Transcript
                  1kym D 14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMP----------------------------VMHYGVFIQNVFDFLIVAFAIFMAI 96
                                    23        33        43         -         -        73        83        93   
                                                        43                           72

Chain D from PDB  Type:PROTEIN  Length:55
 aligned with MSCL_ECOLI | P0A742 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:83
                                    23        33        43        53        63        73        83        93   
            MSCL_ECOLI   14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAI 96
               SCOP domains ----------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............................----------------------------......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------- Transcript
                  1kym D 14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMP----------------------------VMHYGVFIQNVFDFLIVAFAIFMAI 96
                                    23        33        43         -         -        73        83        93   
                                                        43                           72

Chain E from PDB  Type:PROTEIN  Length:55
 aligned with MSCL_ECO57 | P0A743 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:83
                                    23        33        43        53        63        73        83        93   
            MSCL_ECO57   14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAI 96
               SCOP domains ----------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............................----------------------------......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------- Transcript
                  1kym E 14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMP----------------------------VMHYGVFIQNVFDFLIVAFAIFMAI 96
                                    23        33        43         -         -        73        83        93   
                                                        43                           72

Chain E from PDB  Type:PROTEIN  Length:55
 aligned with MSCL_ECOLI | P0A742 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:83
                                    23        33        43        53        63        73        83        93   
            MSCL_ECOLI   14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAI 96
               SCOP domains ----------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............................----------------------------......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------- Transcript
                  1kym E 14 GNVVDLAVGVIIGAAFGKIVSSLVADIIMP----------------------------VMHYGVFIQNVFDFLIVAFAIFMAI 96
                                    23        33        43         -         -        73        83        93   
                                                        43                           72

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Theoretical Model(hide GO term definitions)

Chain A,B,C,D,E (MSCL_ECOLI | P0A742)

molecular function
	GO:0015267	channel activity	Enables the energy-independent facilitated diffusion, mediated by passage of a solute through a transmembrane aqueous pore or channel. Stereospecificity is not exhibited but this transport may be specific for a particular molecular species or class of molecules.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0005216	ion channel activity	Enables the facilitated diffusion of an ion (by an energy-independent process) by passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism. May be either selective (it enables passage of a specific ion only) or non-selective (it enables passage of two or more ions of same charge but different size).
	GO:0008381	mechanically-gated ion channel activity	Enables the transmembrane transfer of an ion by a channel that opens in response to a mechanical stress.
biological process
	GO:0034220	ion transmembrane transport	A process in which an ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain A,B,C,D,E (MSCL_ECO57 | P0A743)

molecular function
	GO:0015267	channel activity	Enables the energy-independent facilitated diffusion, mediated by passage of a solute through a transmembrane aqueous pore or channel. Stereospecificity is not exhibited but this transport may be specific for a particular molecular species or class of molecules.
	GO:0005216	ion channel activity	Enables the facilitated diffusion of an ion (by an energy-independent process) by passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism. May be either selective (it enables passage of a specific ion only) or non-selective (it enables passage of two or more ions of same charge but different size).
biological process
	GO:0034220	ion transmembrane transport	A process in which an ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0055085	transmembrane transport	The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (12, 20)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File