|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1KV0) |
(no "Site" information available for 1KV0) |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
(no "SAP(SNP)/Variant" information available for 1KV0) |
(no "PROSITE Motif" information available for 1KV0) |
(no "Exon" information available for 1KV0) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:66 aligned with SCX7_MESMA | P59854 from UniProtKB/Swiss-Prot Length:66 Alignment length:66 10 20 30 40 50 60 SCX7_MESMA 1 VRDGYIALPHNCAYGCLNNEYCNNLCTKDGAKIGYCNIVGKYGNACWCIQLPDNVPIRVPGRCHPA 66 SCOP domains d1kv0a_ A: Tx10 alpha-like toxin SCOP domains CATH domains 1kv0A00 A:1-66 [code=3.30.30.10, no name defined] CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------ Transcript 1kv0 A 1 VRDGYIALPHNCAYGCLNNEYCNNLCTKDGAKIGYCNIVGKYGNACWCIQLPDNVPIRVPGRCHPA 66 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:66 aligned with SCX7_MESMA | P59854 from UniProtKB/Swiss-Prot Length:66 Alignment length:66 10 20 30 40 50 60 SCX7_MESMA 1 VRDGYIALPHNCAYGCLNNEYCNNLCTKDGAKIGYCNIVGKYGNACWCIQLPDNVPIRVPGRCHPA 66 SCOP domains d1kv0b_ B: Tx10 alpha-like toxin SCOP domains CATH domains 1kv0B00 B:1-66 [code=3.30.30.10, no name defined] CATH domains Pfam domains (1) -Toxin_3-1kv0B01 B:2-55 ----------- Pfam domains (1) Pfam domains (2) -Toxin_3-1kv0B02 B:2-55 ----------- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------ Transcript 1kv0 B 1 VRDGYIALPHNCAYGCLNNEYCNNLCTKDGAKIGYCNIVGKYGNACWCIQLPDNVPIRVPGRCHPA 66 10 20 30 40 50 60
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (SCX7_MESMA | P59854)
|
|
|
|
|
|
|