|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (4, 4)
Asymmetric/Biological Unit
|
||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1KP6) |
SAPs(SNPs)/Variants (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1KP6) |
Exons (0, 0)| (no "Exon" information available for 1KP6) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:79 aligned with KP6T_UMV6 | P16948 from UniProtKB/Swiss-Prot Length:219 Alignment length:79 37 47 57 67 77 87 97 KP6T_UMV6 28 NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLSK 106 SCOP domains d1kp6a_ A: Killer toxin KP6 alpha-subunit SCOP domains CATH domains 1kp6A00 A:1-79 [code=3.30.70.440, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------R---------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------- Transcript 1kp6 A 1 NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLSK 79 10 20 30 40 50 60 70
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1KP6) |
Gene Ontology (1, 1)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (KP6T_UMV6 | P16948)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|