|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1KLS) |
Cis Peptide Bonds (7, 12)
NMR Structure
|
||||||||||||||||||||||||||||||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1KLS) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1KLS) |
Exons (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:30 aligned with ZFY_HUMAN | P08048 from UniProtKB/Swiss-Prot Length:801 Alignment length:30 579 589 599 ZFY_HUMAN 570 KPYQCQYCEYRSADSSNLKTHIKTKHSKEM 599 SCOP domains d1klsa_ A: ZFY SCOP domains CATH domains ------------------------------ CATH domains Pfam domains (1) ----------------zf-H2C2_2-1kl- Pfam domains (1) Pfam domains (2) ----------------zf-H2C2_2-1kl- Pfam domains (2) SAPs(SNPs) ------------------------------ SAPs(SNPs) PROSITE ------------------------------ PROSITE Transcript 1 Exon 1.9c PDB: A:1-30 Transcript 1 1kls A 1 KTYQCQYCELRSADSSNLKTHIKTKHSKEK 30 10 20 30
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1KLS) |
Pfam Domains (1, 2)
NMR Structure
|
Gene Ontology (9, 9)|
NMR Structure(hide GO term definitions) Chain A (ZFY_HUMAN | P08048)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|