Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CITROBACTER AMALONATICUS METHYLASPARTATE AMMONIA LYASE
 
Authors :  C. W. Levy, P. A. Buckley, S. Sedelnikova, Y. Kato, Y. Asano, D. W. Rice, P. J. Baker
Date :  10 Dec 01  (Deposition) - 30 Jan 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.33
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Methylaspartate Ammonia Lyase, Enolase Superfamily, Tim Barrel (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. W. Levy, P. A. Buckley, S. Sedelnikova, Y. Kato, Y. Asano, D. W. Rice, P. J. Baker
Insights Into Enzyme Evolution Revealed By The Structure Of Methylaspartate Ammonia Lyase.
Structure V. 10 105 2002
PubMed-ID: 11796115  |  Reference-DOI: 10.1016/S0969-2126(01)00696-7
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 3-METHYLASPARTATE AMMONIA-LYASE
    ChainsA, B
    EC Number4.3.1.2
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPMAL
    Expression System StrainDL41
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneMAL
    Organism ScientificCITROBACTER AMALONATICUS
    Organism Taxid35703

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 21)

Asymmetric/Biological Unit (2, 21)
No.NameCountTypeFull Name
1MSE20Mod. Amino AcidSELENOMETHIONINE
2SO41Ligand/IonSULFATE ION

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLN A:73 , GLN A:172 , LYS A:331 , THR A:360 , CYS A:361 , HOH A:3039 , HOH A:3107 , HOH A:3277BINDING SITE FOR RESIDUE SO4 A 3001

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:155 -A:162
2B:155 -B:162

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Leu A:192 -Pro A:193
2Lys A:386 -Pro A:387
3Leu B:192 -Pro B:193
4Lys B:386 -Pro B:387

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1KKO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1KKO)

(-) Exons   (0, 0)

(no "Exon" information available for 1KKO)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:411
 aligned with MAAL_CITAM | O66145 from UniProtKB/Swiss-Prot  Length:413

    Alignment length:411
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410 
           MAAL_CITAM     1 MKIKQALFTAGYSSFYFDDQQAIKNGAGHDGFIYTGDPVTPGFTSVRQAGECVSVQLILENGAVAVGDCAAVQYSGAGGRDPLFLAEHFIPFLNDHIKPLLEGRDVDAFLPNARFFDKLRIDGNLLHTAVRYGLSQALLDATALASGRLKTEVVCDEWQLPCVPEAIPLFGQSGDDRYIAVDKMILKGVDVLPHALINNVEEKLGFKGEKLREYVRWLSDRILSLRSSPRYHPTLHIDVYGTIGLIFDMDPVRCAEYIASLEKEAQGLPLYIEGPVDAGNKPDQIRMLTAITKELTRLGSGVKIVADEWCNTYQDIVDFTDAGSCHMVQIKTPDLGGIHNIVDAVLYCNKHGMEAYQGGTCNETEISARTCVHVALAARPMRMLIKPGMGFDEGLNIVFNEMNRTIALLQT 411
               SCOP domains d1kkoa2 A:1-160 beta-Methylaspartase                                                                                                                            d1kkoa1 A:161-411 beta-Methylaspartase                                                                                                                                                                                                                      SCOP domains
               CATH domains -1kkoA01 A:2-164 Enolase-like, N-terminal domain                                                                                                                    1kkoA02 A:165-411 Enolase superfamily                                                                                                                                                                                                                   CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeeeeeeeehhhhhhh...ee..ee............eeeeeeeeeeeee....eeeeee...............hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhee..ee.hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh..........ee.......hhhhhhhhhh...eeee.............hhhhhhhhhhhhhhhhhhh.......eeeee..hhhhhhh..hhhhhhhhhhhhhhhhh...eeee......hhhhhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhh....eeeehhhhhhhhhhhhhhhhhhhhhh.eeee......hhhhhhhhhhhhhhhh..eee......hhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kko A   1 mKIKQALFTAGYSSFYFDDQQAIKNGAGHDGFIYTGDPVTPGFTSVRQAGECVSVQLILENGAVAVGDCAAVQYSGAGGRDPLFLAEHFIPFLNDHIKPLLEGRDVDAFLPNARFFDKLRIDGNLLHTAVRYGLSQALLDATALASGRLKTEVVCDEWQLPCVPEAIPLFGQSGDDRYIAVDKmILKGVDVLPHALINNVEEKLGFKGEKLREYVRWLSDRILSLRSSPRYHPTLHIDVYGTIGLIFDmDPVRCAEYIASLEKEAQGLPLYIEGPVDAGNKPDQIRmLTAITKELTRLGSGVKIVADEWCNTYQDIVDFTDAGSCHmVQIKTPDLGGIHNIVDAVLYCNKHGmEAYQGGTCNETEISARTCVHVALAARPmRmLIKPGmGFDEGLNIVFNEmNRTIALLQT 411
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180   |   190       200       210       220       230       240       250       260       270       280      |290       300       310       320      |330       340       350  |    360       370       380| |    390       400 |     410 
                            |                                                                                                                                                                                    184-MSE                                                          249-MSE                               287-MSE                                 327-MSE                   353-MSE                     381-MSE   |          402-MSE     
                            1-MSE                                                                                                                                                                                                                                                                                                                                                                                       383-MSE |                      
                                                                                                                                                                                                                                                                                                                                                                                                                              389-MSE                  

Chain B from PDB  Type:PROTEIN  Length:411
 aligned with MAAL_CITAM | O66145 from UniProtKB/Swiss-Prot  Length:413

    Alignment length:411
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410 
           MAAL_CITAM     1 MKIKQALFTAGYSSFYFDDQQAIKNGAGHDGFIYTGDPVTPGFTSVRQAGECVSVQLILENGAVAVGDCAAVQYSGAGGRDPLFLAEHFIPFLNDHIKPLLEGRDVDAFLPNARFFDKLRIDGNLLHTAVRYGLSQALLDATALASGRLKTEVVCDEWQLPCVPEAIPLFGQSGDDRYIAVDKMILKGVDVLPHALINNVEEKLGFKGEKLREYVRWLSDRILSLRSSPRYHPTLHIDVYGTIGLIFDMDPVRCAEYIASLEKEAQGLPLYIEGPVDAGNKPDQIRMLTAITKELTRLGSGVKIVADEWCNTYQDIVDFTDAGSCHMVQIKTPDLGGIHNIVDAVLYCNKHGMEAYQGGTCNETEISARTCVHVALAARPMRMLIKPGMGFDEGLNIVFNEMNRTIALLQT 411
               SCOP domains d1kkob2 B:1-160 beta-Methylaspartase                                                                                                                            d1kkob1 B:161-411 beta-Methylaspartase                                                                                                                                                                                                                      SCOP domains
               CATH domains -1kkoB01 B:2-164 Enolase-like, N-terminal domain                                                                                                                    1kkoB02 B:165-401 Enolase superfamily                                                                                                                                                                                                        ---------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeeeeeeeehhhhhhhhheee..eee...........eeeeeeeeeeeee....eeeeee...............hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhee..ee.hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh.........ee.......hhhhhhhhhh...eeee.............hhhhhhhhhhhhhhhhhhh.......eeeee..hhhhhhh..hhhhhhhhhhhhhhhhh...eeee......hhhhhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhh....eeeehhhhhhhhhhhhhhhhhhhhh..eeee......hhhhhhhhhhhhhhhh..eee......hhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kko B   1 mKIKQALFTAGYSSFYFDDQQAIKNGAGHDGFIYTGDPVTPGFTSVRQAGECVSVQLILENGAVAVGDCAAVQYSGAGGRDPLFLAEHFIPFLNDHIKPLLEGRDVDAFLPNARFFDKLRIDGNLLHTAVRYGLSQALLDATALASGRLKTEVVCDEWQLPCVPEAIPLFGQSGDDRYIAVDKmILKGVDVLPHALINNVEEKLGFKGEKLREYVRWLSDRILSLRSSPRYHPTLHIDVYGTIGLIFDmDPVRCAEYIASLEKEAQGLPLYIEGPVDAGNKPDQIRmLTAITKELTRLGSGVKIVADEWCNTYQDIVDFTDAGSCHmVQIKTPDLGGIHNIVDAVLYCNKHGmEAYQGGTCNETEISARTCVHVALAARPmRmLIKPGmGFDEGLNIVFNEmNRTIALLQT 411
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180   |   190       200       210       220       230       240       250       260       270       280      |290       300       310       320      |330       340       350  |    360       370       380| |    390       400 |     410 
                            1-MSE                                                                                                                                                                                184-MSE                                                          249-MSE                               287-MSE                                 327-MSE                   353-MSE                     381-MSE   |          402-MSE     
                                                                                                                                                                                                                                                                                                                                                                                                                        383-MSE |                      
                                                                                                                                                                                                                                                                                                                                                                                                                              389-MSE                  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1KKO)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (MAAL_CITAM | O66145)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0050096    methylaspartate ammonia-lyase activity    Catalysis of the reaction: threo-3-methyl-L-aspartate = mesaconate + NH(4)(+).
biological process
    GO:0019553    glutamate catabolic process via L-citramalate    The chemical reactions and pathways resulting in the breakdown of glutamate, via the intermediate L-citramalate.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Leu A:192 - Pro A:193   [ RasMol ]  
    Leu B:192 - Pro B:193   [ RasMol ]  
    Lys A:386 - Pro A:387   [ RasMol ]  
    Lys B:386 - Pro B:387   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1kko
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MAAL_CITAM | O66145
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.3.1.2
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MAAL_CITAM | O66145
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MAAL_CITAM | O661451kkr

(-) Related Entries Specified in the PDB File

1kkr CRYSTAL STRUCTURE OF CITROBACTER AMALONATICUS METHYLASPARTATE AMMONIA LYASE CONTAINING (2S,3S)-3- METHYLASPARTIC ACID