Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF PYROBACULUM AEROPHILUM DSRC/GAMMA SUBUNIT OF DISSIMILATORY SULFITE REDUCTASE
 
Authors :  J. R. Cort, M. A. Kennedy, Northeast Structural Genomics Consortium (Nesg)
Date :  29 Jun 01  (Deposition) - 05 Dec 01  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Orthogonal Helical Bundle, Structural Genomics, Psi, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. R. Cort, S. V. Mariappan, C. Y. Kim, M. S. Park, T. S. Peat, G. S. Waldo, T. C. Terwilliger, M. A. Kennedy
Solution Structure Of Pyrobaculum Aerophilum Dsrc, An Archaeal Homologue Of The Gamma Subunit Of Dissimilatory Sulfite Reductase.
Eur. J. Biochem. V. 268 5842 2001
PubMed-ID: 11722571  |  Reference-DOI: 10.1046/J.0014-2956.2001.02529.X
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - DISSIMILATORY SIROHEME-SULFITE REDUCTASE
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidMODIFIED PET28B
    Expression System StrainBL221(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentGAMMA SUBUNIT
    GeneDSRC
    Organism ScientificPYROBACULUM AEROPHILUM
    Organism Taxid13773

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1JI8)

(-) Sites  (0, 0)

(no "Site" information available for 1JI8)

(-) SS Bonds  (2, 2)

NMR Structure
No.Residues
1A:5 -A:22
2A:69 -A:99

(-) Cis Peptide Bonds  (1, 20)

NMR Structure
No.ModelResidues
11, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20Cys A:5 -Pro A:6

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1JI8)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1JI8)

(-) Exons   (0, 0)

(no "Exon" information available for 1JI8)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:111
 aligned with Q8ZUX1_PYRAE | Q8ZUX1 from UniProtKB/TrEMBL  Length:111

    Alignment length:111
                                    10        20        30        40        50        60        70        80        90       100       110 
         Q8ZUX1_PYRAE     1 MPVKCPGEYQVDGKKVILDEDCFMQNPEDWDEKVAEWLARELEGIQKMTEEHWKLVKYLREYWETFGSCPPIKMVTKETGFSLEKIYQLFPSGPAHGACKVAGAPKPTGCV 111
               SCOP domains d1ji8a_ A: DsrC, the gamma subunit of dissimilatory sulfite reductase                                           SCOP domains
               CATH domains 1ji8A01 A:1-47                                 1ji8A02 A:48-111  [code=1.10.10.370, no name defined]            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee....eeeeehhhee.hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh..........hhhhhh..hhhhhhhhh..hhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------- Transcript
                 1ji8 A   1 MPVKCPGEYQVDGKKVILDEDCFMQNPEDWDEKVAEWLARELEGIQKMTEEHWKLVKYLREYWETFGTCPPIKMVTKETGFSLEKIYQLFPSGPAHGACKVAGAPKPTGCV 111
                                    10        20        30        40        50        60        70        80        90       100       110 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (2, 2)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1JI8)

(-) Gene Ontology  (0, 0)

NMR Structure(hide GO term definitions)
    (no "Gene Ontology" information available for 1JI8)

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ji8)
 
  Sites
(no "Sites" information available for 1ji8)
 
  Cis Peptide Bonds
    Cys A:5 - Pro A:6   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ji8
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8ZUX1_PYRAE | Q8ZUX1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q8ZUX1_PYRAE | Q8ZUX1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1JI8)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1JI8)