Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF PYROBACULUM AEROPHILUM DSRC/GAMMA SUBUNIT OF DISSIMILATORY SULFITE REDUCTASE
 
Authors :  J. R. Cort, M. A. Kennedy, Northeast Structural Genomics Consortium (Nesg)
Date :  29 Jun 01  (Deposition) - 05 Dec 01  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Orthogonal Helical Bundle, Structural Genomics, Psi, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. R. Cort, S. V. Mariappan, C. Y. Kim, M. S. Park, T. S. Peat, G. S. Waldo, T. C. Terwilliger, M. A. Kennedy
Solution Structure Of Pyrobaculum Aerophilum Dsrc, An Archaeal Homologue Of The Gamma Subunit Of Dissimilatory Sulfite Reductase.
Eur. J. Biochem. V. 268 5842 2001
PubMed-ID: 11722571  |  Reference-DOI: 10.1046/J.0014-2956.2001.02529.X
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - DISSIMILATORY SIROHEME-SULFITE REDUCTASE
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: MODIFIED PET28B
    Expression System Strain: BL221(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: GAMMA SUBUNIT
    Gene: DSRC
    Organism Scientific: PYROBACULUM AEROPHILUM
    Organism Taxid: 13773

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1JI8)

(-) Sites  (0, 0)

(no "Site" information available for 1JI8)

(-) SS Bonds  (2, 2)

NMR Structure
No.Residues
1A:5 -A:22
2A:69 -A:99

(-) Cis Peptide Bonds  (1, 20)

NMR Structure
No.ModelResidues
11, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20Cys A:5 -Pro A:6

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1JI8)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1JI8)

(-) Exons   (0, 0)

(no "Exon" information available for 1JI8)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:111
 aligned with Q8ZUX1_PYRAE | Q8ZUX1 from UniProtKB/TrEMBL  Length:111

    Alignment length:111
                                    10        20        30        40        50        60        70        80        90       100       110 
         Q8ZUX1_PYRAE     1 MPVKCPGEYQVDGKKVILDEDCFMQNPEDWDEKVAEWLARELEGIQKMTEEHWKLVKYLREYWETFGSCPPIKMVTKETGFSLEKIYQLFPSGPAHGACKVAGAPKPTGCV 111
               SCOP domains d1ji8a_ A: DsrC, the gamma subunit of dissimilatory sulfite reductase                                           SCOP domains
               CATH domains 1ji8A01 A:1-47                                 1ji8A02 A:48-111  [code=1.10.10.370, no name defined]            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee....eeeeehhhee.hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh..........hhhhhh..hhhhhhhhh..hhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------- Transcript
                 1ji8 A   1 MPVKCPGEYQVDGKKVILDEDCFMQNPEDWDEKVAEWLARELEGIQKMTEEHWKLVKYLREYWETFGTCPPIKMVTKETGFSLEKIYQLFPSGPAHGACKVAGAPKPTGCV 111
                                    10        20        30        40        50        60        70        80        90       100       110
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (2, 2)

NMR Structure
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1JI8)

(-) Gene Ontology  (0, 0)

NMR Structure(hide GO term definitions)
    (no "Gene Ontology" information available for 1JI8)

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ji8)
 
  Sites
(no "Sites" information available for 1ji8)
 
  Cis Peptide Bonds
    Cys A:5 - Pro A:6   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ji8
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8ZUX1_PYRAE | Q8ZUX1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8ZUX1_PYRAE | Q8ZUX1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1JI8)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1JI8)