|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (1, 1)
Asymmetric Unit
|
||||||||
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1JER) |
PROSITE Motifs (2, 2)
Asymmetric Unit (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1JER) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:110 aligned with CPC_CUCSA | P29602 from UniProtKB/Swiss-Prot Length:137 Alignment length:110 1 | 9 19 29 39 49 59 69 79 89 99 109 CPC_CUCSA - -QSTVHIVGDNTGWSVPSSPNFYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFDACNFVNSDNDVERTSPVIERLDELGMHYFVCTVGTHCSNGQKLSINVVAAN 109 SCOP domains d1jera_ A: Stellacyanin SCOP domains CATH domains 1jerA00 A:0-109 Cupredoxins - blue copper proteins CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---PHYTOCYANIN PDB: A:3-107 UniProt: 3-107 -- PROSITE (1) PROSITE (2) -----------------------------------------------------------------------------------COPPER_BLUE ---------- PROSITE (2) Transcript -------------------------------------------------------------------------------------------------------------- Transcript 1jer A 0 MQSTVHIVGDNTGWSVPSSPNFYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFDACNFVNSDNDVERTSPVIERLDELGMHYFVCTVGTHCSNGQKLSINVVAAN 109 9 19 29 39 49 59 69 79 89 99 109
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1JER) |
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A (CPC_CUCSA | P29602)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|