|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)
Asymmetric Unit (2, 4)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1JEO) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1JEO) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1JEO) |
PROSITE Motifs (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1JEO) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:177 aligned with PHI_METJA | Q58644 from UniProtKB/Swiss-Prot Length:180 Alignment length:177 13 23 33 43 53 63 73 83 93 103 113 123 133 143 153 163 173 PHI_METJA 4 LEELDIVSNNILILKKFYTNDEWKNKLDSLIDRIIKAKKIFIFGVGRSGYIGRCFAMRLMHLGFKSYFVGETTTPSYEKDDLLILISGSGRTESVLTVAKKAKNINNNIIAIVCECGNVVEFADLTIPLEVKKSKYLPMGTTFEETALIFLDLVIAEIMKRLNLDESEIIKRHCNLL 180 SCOP domains d1jeoa_ A: Probable 3-hexulose-6-phosphate isomerase MJ1247 SCOP domains CATH domains 1jeoA00 A:4-180 Glucose-6-phosphate isomerase like protein; domain 1 CATH domains Pfam domains --------------------------------SIS-1jeoA01 A:36-158 ---------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----------------------------SIS PDB: A:33-167 UniProt: 33-167 ------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1jeo A 4 LEELDIVSNNILILKKFYTNDEWKNKLDSLIDRIIKAKKIFIFGVGRSGYIGRCFAMRLMHLGFKSYFVGETTTPSYEKDDLLILISGSGRTESVLTVAKKAKNINNNIIAIVcEcGNVVEFADLTIPLEVKKSKYLPMGTTFEETALIFLDLVIAEIMKRLNLDESEIIKRHcNLL 180 13 23 33 43 53 63 73 83 93 103 113 | | 123 133 143 153 163 173 | 117-CME 177-CME 119-CME
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (6, 6)|
Asymmetric Unit(hide GO term definitions) Chain A (PHI_METJA | Q58644)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|