Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF MTH1692 PROTEIN FROM METHANOBACTERIUM THERMOAUTOTROPHICUM
 
Authors :  G. Kozlov, I. Ekiel, K. Gehring
Date :  11 Jun 01  (Deposition) - 24 Jul 02  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Mixed Alpha-Beta Structure, Structural Genomics (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Yee, X. Chang, A. Pineda-Lucena, B. Wu, A. Semesi, B. Le, T. Ramelot, G. M. Lee, S. Bhattacharyya, P. Gutierrez, A. Denisov, C. H. Lee, J. R. Cort, G. Kozlov, J. Liao, G. Finak, L. Chen, D. Wishart, W. Lee, L. P. Mcintosh, K. Gehring, M. A. Kennedy, A. M. Edwards, C. H. Arrowsmith
An Nmr Approach To Structural Proteomics.
Proc. Natl. Acad. Sci. Usa V. 99 1825 2002
PubMed-ID: 11854485  |  Reference-DOI: 10.1073/PNAS.042684599
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CONSERVED PROTEIN MTH1692
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET15B
    Expression System Strain: BL21(DE3) GOLD MAGIC
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Organism Scientific: METHANOTHERMOBACTER THERMAUTOTROPHICUS
    Organism Taxid: 145262

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1JCU)

(-) Sites  (0, 0)

(no "Site" information available for 1JCU)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1JCU)

(-) Cis Peptide Bonds  (2, 40)

NMR Structure
No.ModelResidues
11, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20Leu A:92 -Pro A:93
21, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20Glu A:175 -Pro A:176

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1JCU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1JCU)

(-) Exons   (0, 0)

(no "Exon" information available for 1JCU)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:208
 aligned with O27727_METTH | O27727 from UniProtKB/TrEMBL  Length:208

    Alignment length:208
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200        
         O27727_METTH     1 MLIRKITRKNPSPDVLEEAISVMEGGGIVIYPTDTIYGLGVNALDEDAVRRLFRVKGRSPHKPVSICVSCVDEIPRFSRPSGDAMELMERILPGPYTVVLERNELIPDVITGGSSRVGIRVPDDEICRRIAARFPVTATSANISGKPPSPRLEEIVRDLDAVDLVLDAGDCLDMEPSTVIDLTVNPPRVLRRGKGPLDPVLLRGAGDV 208
               SCOP domains d1jcua_ A: Hypothetical protein MTH1692                                                                                                                                                                          SCOP domains
               CATH domains 1jcuA00 A:1-208 DHBP synthase                                                                                                                                                                                    CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhh..eee.......eeeee..hhhhhhhhhhhh........eee..........ee.hhhhhhhhhhh....eeeeeee....hhhhhh...eeeee...hhhhhhhhhhh.eeeee..........hhhhhhhhh...ee.............eee........eee................. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1jcu A   1 MLIRKITRKNPSPDVLEEAISVMEGGGIVIYPTDTIYGLGVNALDEDAVRRLFRVKGRSPHKPVSICVSCVDEIPRFSRPSGDAMELMERILPGPYTVVLERNELIPDVITGGSSRVGIRVPDDEICRRIAARFPVTATSANISGKPPSPRLEEIVRDLDAVDLVLDAGDCLDMEPSTVIDLTVNPPRVLRRGKGPLDPVLLRGAGDV 208
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1JCU)

(-) Gene Ontology  (1, 1)

NMR Structure(hide GO term definitions)
Chain A   (O27727_METTH | O27727)
molecular function
    GO:0003725    double-stranded RNA binding    Interacting selectively and non-covalently with double-stranded RNA.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1jcu)
 
  Sites
(no "Sites" information available for 1jcu)
 
  Cis Peptide Bonds
    Glu A:175 - Pro A:176   [ RasMol ]  
    Leu A:92 - Pro A:93   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1jcu
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O27727_METTH | O27727
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  O27727_METTH | O27727
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1JCU)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1JCU)