|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1JA3) |
Sites (0, 0)| (no "Site" information available for 1JA3) |
SS Bonds (8, 8)
Asymmetric/Biological Unit
|
||||||||||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1JA3) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1JA3) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1JA3) |
Exons (0, 0)| (no "Exon" information available for 1JA3) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:115 aligned with Q9JHN9_MOUSE | Q9JHN9 from UniProtKB/TrEMBL Length:266 Alignment length:122 153 163 173 183 193 203 213 223 233 243 253 263 Q9JHN9_MOUSE 144 VKYWFCYGTKCYYFIMNKTTWSGCKANCQHYSVPIVKIEDEDELKFLQRHVIPEGYWIGLSYDKKKKEWAWIDNGPSKFDMKIRKMNFKSRGCVFLSKARIEDTDCNIPYYCICGKKLDKFP 265 SCOP domains d1ja3a_ A: NK cell receptor SCOP domains CATH domains 1ja3A00 A:140-261 Mannose-Binding Protein A, subunit A CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript 1ja3 A 140 VKYWFCYGTKCYYFIMNKTTWSGCKANCQHYSVPIVKIEDEDELKFLQRHVIPEGYWIGLSYDKKKKEWAWIDNGPSKFDMK-------SRGCVFLSKARIEDTDCNIPYYCICGKKLDKFP 261 149 159 169 179 189 199 209 219 | 229 239 249 259 221 229 Chain B from PDB Type:PROTEIN Length:113 aligned with Q9JHN9_MOUSE | Q9JHN9 from UniProtKB/TrEMBL Length:266 Alignment length:121 153 163 173 183 193 203 213 223 233 243 253 263 Q9JHN9_MOUSE 144 VKYWFCYGTKCYYFIMNKTTWSGCKANCQHYSVPIVKIEDEDELKFLQRHVIPEGYWIGLSYDKKKKEWAWIDNGPSKFDMKIRKMNFKSRGCVFLSKARIEDTDCNIPYYCICGKKLDKF 264 SCOP domains d1ja3b_ B: NK cell receptor SCOP domains CATH domains 1ja3B00 B:140-260 Mannose-Binding Protein A, subunit A CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript 1ja3 B 140 VKYWFCYGTKCYYFIMNKTTWSGCKANCQHYSVPIVKIEDEDELKFLQRHVIPEGYWIGLSYDKKKKEWAWIDN---KFDMK-----FKSRGCVFLSKARIEDTDCNIPYYCICGKKLDKF 260 149 159 169 179 189 199 209 | 220 | 229 239 249 259 213 218 222 227
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1JA3) |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q9JHN9_MOUSE | Q9JHN9)
|
||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|