Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  SIGNAL RECOGNITION PARTICLE CONSERVED GTPASE DOMAIN FROM A. AMBIVALENS T112A MUTANT
 
Authors :  G. Montoya, K. Te Kaat, R. Moll, G. Schaerfer, I. Sinning
Date :  23 May 01  (Deposition) - 13 Jun 01  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  F
Keywords :  Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. Montoya, K. Kaat, R. Moll, G. Schafer, I. Sinning
The Crystal Structure Of The Conserved Gtpase Of Srp54 From The Archaeon Acidianus Ambivalens And Its Comparison With Related Structures Suggests A Model For The Srp-Srp Receptor Complex.
Structure Fold. Des. V. 8 515 2000
PubMed-ID: 10801496  |  Reference-DOI: 10.1016/S0969-2126(00)00131-3
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - SIGNAL RECOGNITION 54 KDA PROTEIN
    ChainsF
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21
    Expression System PlasmidPET16
    Expression System StrainBL21
    Expression System Taxid511693
    FragmentG-DOMAIN, GTPASE DOMAIN
    MutationYES
    Organism ScientificACIDIANUS AMBIVALENS
    Organism Taxid2283
    SynonymSRP54

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit F

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1J8Y)

(-) Sites  (0, 0)

(no "Site" information available for 1J8Y)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1J8Y)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Ile F:97 -Pro F:98

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1J8Y)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1J8Y)

(-) Exons   (0, 0)

(no "Exon" information available for 1J8Y)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain F from PDB  Type:PROTEIN  Length:291
 aligned with SRP54_ACIAM | P70722 from UniProtKB/Swiss-Prot  Length:451

    Alignment length:295
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292     
          SRP54_ACIAM     3 LLDNLRDAVRKFLTGSSSYDKAVEDFIKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIERREWFIKIVYDELSNLFGGDKEPKVIPDKIPYVIMLVGVQGTGKTTTAGKLAYFYKKKGFKVGLVGADVYRPAALEQLQQLGQQIGVPVYGEPGEKDAVGIAKRGVEKFLSEKMEIIIVDTAGRHGYGEEAALLEEMKNIYEAIKPDEVTLVIDASIGQKAYDLASKFNQASKIGTIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELEVFNPRRFVARILGMG 297
               SCOP domains d1j8yf1 F:3-86 Signal sequence recognition protein Ffh                              d1j8yf2 F:87-297 GTPas    e domain of the signal sequence recognition protein Ffh                                                                                                                                   SCOP domains
               CATH domains 1j8yF01 F:3-88  [code=1.20.120.140, no name defined]                                  1j8yF02 F:89-283 P-l    oop containing nucleotide triphosphate hydrolases                                                                                                                          -------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh..............eeeeee....----hhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhhhhh..ee......hhhhhhhhhhhhhhhh...eeeee........hhhhhhhhhhhhhhhhh..eeeeeee.hhhhhhhhhhhhhhhhh..eeeeee......hhhhhhhhhhh....eeeee.......eee.hhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1j8y F   3 LLDNLRDTVRKFLTGSSSYDKAVEDFIKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIERREWFIKIVYDELSNLFGGDKEPKVIPDKIPYVIMLVGVQG----TTAGKLAYFYKKKGFKVGLVGADVYRPAALEQLQQLGQQIGVPVYGEPGEKDVVGIAKRGVEKFLSEKMEIIIVDTAGRHGYGEEAALLEEMKNIYEAIKPDEVTLVIDASIGQKAYDLASKFNQASKIGTIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELEVFNPRRFVARLHHHH 297
                                    12        22        32        42        52        62        72        82        92       102     |   -|      122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292     
                                                                                                                                   108  113                                                                                                                                                                                        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1J8Y)

(-) Gene Ontology  (9, 9)

Asymmetric/Biological Unit(hide GO term definitions)
Chain F   (SRP54_ACIAM | P70722)
molecular function
    GO:0008312    7S RNA binding    Interacting selectively and non-covalently with 7S RNA, the RNA component of the signal recognition particle (SRP).
    GO:0005525    GTP binding    Interacting selectively and non-covalently with GTP, guanosine triphosphate.
    GO:0003924    GTPase activity    Catalysis of the reaction: GTP + H2O = GDP + phosphate.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0006614    SRP-dependent cotranslational protein targeting to membrane    The targeting of proteins to a membrane that occurs during translation and is dependent upon two key components, the signal-recognition particle (SRP) and the SRP receptor. SRP is a cytosolic particle that transiently binds to the endoplasmic reticulum (ER) signal sequence in a nascent protein, to the large ribosomal unit, and to the SRP receptor in the ER membrane.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0048500    signal recognition particle    A complex of protein and RNA which facilitates translocation of proteins across membranes.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1j8y)
 
  Sites
(no "Sites" information available for 1j8y)
 
  Cis Peptide Bonds
    Ile F:97 - Pro F:98   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1j8y
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SRP54_ACIAM | P70722
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SRP54_ACIAM | P70722
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SRP54_ACIAM | P707221j8m

(-) Related Entries Specified in the PDB File

1j8m