|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1J7R) |
Sites (0, 0)| (no "Site" information available for 1J7R) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1J7R) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1J7R) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1J7R) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1J7R) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:77 aligned with CAVP_BRALA | P04573 from UniProtKB/Swiss-Prot Length:162 Alignment length:77 18 28 38 48 58 68 78 CAVP_BRALA 9 LGPEEKDECMKIFDIFDRNAENIAPVSDTMDMLTKLGQTYTKRETEAIMKEARGPKGDKKNIGPEEWLTLCSKWVRQ 85 SCOP domains d1j7ra_ A: Calcium vector protein SCOP domains CATH domains 1j7rA00 A:8-84 EF-hand CATH domains Pfam domains ----------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---EF_HAND_2 PDB: A:11-46 -------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------- Transcript 1j7r A 8 LGPEEKDECMKIFDIFDRNAENIAPVSDTMDMLTKLGQTYTKRETEAIMKEARGPKGDKKNIGPEEWLTLCSKWVRQ 84 17 27 37 47 57 67 77
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1J7R) |
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (CAVP_BRALA | P04573)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|