Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF ACTIVATION (ADOMET BINDING) DOMAIN OF METHIONINE SYNTHASE (TM0269) FROM THERMOTOGA MARITIMA AT 2.2 A RESOLUTION
 
Authors :  Joint Center For Structural Genomics (Jcsg)
Date :  10 Jul 02  (Deposition) - 14 Aug 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Structural Genomics, Tm0269, Activation (Adomet Binding) Domain Of Methionine Synthase, Jcsg, Psi, Protein Structure Initiative, Joint Center For Structural Genomics, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Joint Center For Structural Genomics (Jcsg)
Crystal Structure Of Activation (Adomet Binding) Domain Of Methionine Synthase (Tm0269) From Thermotoga Maritima At 2. 2 A Resolution
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - METHIONINE SYNTHASE
    Chains: A, B
    EC Number: 2.1.1.13
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: ACTIVATION (ADOMET BINDING) DOMAIN
    Gene: TM0269
    Organism Scientific: THERMOTOGA MARITIMA
    Organism Taxid: 2336

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1J6R)

(-) Sites  (0, 0)

(no "Site" information available for 1J6R)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1J6R)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Val A:185 -Pro A:186
2Val B:185 -Pro B:186

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1J6R)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1J6R)

(-) Exons   (0, 0)

(no "Exon" information available for 1J6R)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:197
 aligned with Q9WYA6_THEMA | Q9WYA6 from UniProtKB/TrEMBL  Length:202

    Alignment length:197
                              1                                                                                                                                                                                                  
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       
         Q9WYA6_THEMA     - --MPKVEIAPSEIKIPDNVLKAKLGFGGAEEIPEEFRKTVNRAYEELLDAAKPVVLWRDFEVDGSLSFDDMRLTGELATKHLSGSKIITVFLATLGKKVDEKIEEYFRKGEDLLAFFIDGIASEMVEYALRKVDAELRMKRSNLEGSFRISPGYGDLPLSLNKKIAEIFKEEVDVNVIEDSYVLVPRKTITAFVGWR 195
               SCOP domains d1j6ra_ A: Hypothetical protein TM0269                                                                                                                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee.hhhhh..hhhhhhhhh........hhhhhhhhhhhhhhhhhhh..eeeeeeee.............hhhhhhhhh...eeeeeeee.hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...ee.............hhhhhhhhhhh..................eeeeeeeee Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1j6r A   1 HHMPKVEIAPSEIKIPDNVLKAKLGFGGAEEIPEEFRKTVNRAYEELLDAAKPVVLWRDFEVDGSLSFDDMRLTGELATKHLSGSKIITVFLATLGKKVDEKIEEYFRKGEDLLAFFIDGIASEMVEYALRKVDAELRMKRSNLEGSFRISPGYGDLPLSLNKKIAEIFKEEVDVNVIEDSYVLVPRKTITAFVGWR 197
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       


Chain B from PDB  Type:PROTEIN  Length:197
 aligned with Q9WYA6_THEMA | Q9WYA6 from UniProtKB/TrEMBL  Length:202

    Alignment length:197
                              1                                                                                                                                                                                                  
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       
         Q9WYA6_THEMA     - --MPKVEIAPSEIKIPDNVLKAKLGFGGAEEIPEEFRKTVNRAYEELLDAAKPVVLWRDFEVDGSLSFDDMRLTGELATKHLSGSKIITVFLATLGKKVDEKIEEYFRKGEDLLAFFIDGIASEMVEYALRKVDAELRMKRSNLEGSFRISPGYGDLPLSLNKKIAEIFKEEVDVNVIEDSYVLVPRKTITAFVGWR 195
               SCOP domains d1j6rb_ B: Hypothetical protein TM0269                                                                                                                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee.hhhhh..hhhhhhhhh........hhhhhhhhhhhhhhhhhhh..eeeee........ee..ee..hhhhhhhhh...eeeeeeee.hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...ee.............hhhhhhhhhhhhh................eeeeeeeee Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1j6r B   1 HHMPKVEIAPSEIKIPDNVLKAKLGFGGAEEIPEEFRKTVNRAYEELLDAAKPVVLWRDFEVDGSLSFDDMRLTGELATKHLSGSKIITVFLATLGKKVDEKIEEYFRKGEDLLAFFIDGIASEMVEYALRKVDAELRMKRSNLEGSFRISPGYGDLPLSLNKKIAEIFKEEVDVNVIEDSYVLVPRKTITAFVGWR 197
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1J6R)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1J6R)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q9WYA6_THEMA | Q9WYA6)
molecular function
    GO:0008705    methionine synthase activity    Catalysis of the reaction: (6S)-5-methyl-5,6,7,8-tetrahydrofolate + L-homocysteine = (6S)-5,6,7,8-tetrahydrofolate + L-methionine.
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0009086    methionine biosynthetic process    The chemical reactions and pathways resulting in the formation of methionine (2-amino-4-(methylthio)butanoic acid), a sulfur-containing, essential amino acid found in peptide linkage in proteins.
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1j6r)
 
  Sites
(no "Sites" information available for 1j6r)
 
  Cis Peptide Bonds
    Val A:185 - Pro A:186   [ RasMol ]  
    Val B:185 - Pro B:186   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1j6r
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9WYA6_THEMA | Q9WYA6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.1.1.13
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9WYA6_THEMA | Q9WYA6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1J6R)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1J6R)